Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79670 78 / 4e-18 WAKL22, RFO1 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2) AT1G19390 77 / 1e-17 Wall-associated kinase family protein (.1) AT1G16130 76 / 4e-17 WAKL2 wall associated kinase-like 2 (.1) AT1G79680 75 / 5e-17 ATWAKL10 WALL ASSOCIATED KINASE (WAK)-LIKE 10 (.1) AT1G16150 73 / 3e-16 WAKL4 wall associated kinase-like 4 (.1) AT1G16260 72 / 4e-16 Wall-associated kinase family protein (.1.2) AT1G17910 72 / 6e-16 Wall-associated kinase family protein (.1) AT4G31100 71 / 1e-15 wall-associated kinase, putative (.1) AT4G31110 69 / 6e-15 Wall-associated kinase family protein (.1) AT1G69730 68 / 1e-14 Wall-associated kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G040000 [exp] 215 / 1e-67 AT1G79670 604 / 0.0 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2) Potri.009G154300 [exp] 112 / 2e-30 AT1G16130 423 / 4e-142 wall associated kinase-like 2 (.1) Potri.003G185622 [exp] 111 / 7e-30 AT1G16260 551 / 0.0 Wall-associated kinase family protein (.1.2) Potri.003G185688 [exp] 110 / 2e-29 AT1G16260 615 / 0.0 Wall-associated kinase family protein (.1.2) Potri.003G185700 [exp] 110 / 2e-29 AT1G16260 622 / 0.0 Wall-associated kinase family protein (.1.2) Potri.009G157201 [exp] 105 / 1e-27 AT1G16260 500 / 4e-167 Wall-associated kinase family protein (.1.2) Potri.001G040628 [exp] 104 / 3e-27 AT1G16260 612 / 0.0 Wall-associated kinase family protein (.1.2) Potri.003G186100 [exp] 103 / 5e-27 AT1G16260 625 / 0.0 Wall-associated kinase family protein (.1.2) Potri.001G039450 [exp] 99 / 2e-25 AT1G79670 613 / 0.0 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034085 [exp] 58 / 5e-11 AT1G16130 526 / 5e-179 wall associated kinase-like 2 (.1) Lus10003063 [exp] 55 / 7e-10 AT1G16130 514 / 2e-173 wall associated kinase-like 2 (.1) Lus10008105 [exp] 52 / 6e-09 AT1G16120 419 / 3e-137 wall associated kinase-like 1 (.1) Lus10038077 [exp] 52 / 6e-09 AT1G21270 576 / 0.0 wall-associated kinase 2 (.1) Lus10004504 [exp] 48 / 2e-07 AT1G16130 411 / 5e-134 wall associated kinase-like 2 (.1) Lus10013143 [exp] 48 / 2e-07 AT1G16160 270 / 2e-85 wall associated kinase-like 5 (.1) Lus10040135 [exp] 45 / 2e-06 AT5G47070 456 / 3e-160 Protein kinase superfamily protein (.1) Lus10027589 [exp] 44 / 6e-06 AT2G07180 545 / 0.0 Protein kinase superfamily protein (.1.2) Lus10008546 [exp] 43 / 1e-05 AT2G07180 534 / 0.0 Protein kinase superfamily protein (.1.2) Lus10030308 [exp] 43 / 1e-05 AT3G46290 735 / 0.0 hercules receptor kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G040884.1 pacid=42789137 polypeptide=Potri.001G040884.1.p locus=Potri.001G040884 ID=Potri.001G040884.1.v4.1 annot-version=v4.1 ATGTTGATGGAAGACAATAGACTGTCTGATATTCTTGATGCTAGAGTTAAGGAGGGCTGTCAGAATGAAGAAGTTATCTCTGTTGCTAATCTTGCGAAAA GATGCTTGAATTTGAATGGGAAAAATCGACCTACAATGCGAGAAGTCACATCAGAGTTGGAGAGGATAATTGGATTGTCTCAAGAAGAGCTAAATATTCA AGAGAACTGTAAAATATCAGAAAACACCATGGATGATGCAAGCAATGATTGGGATGCAGTTTCGACATCAATCACTGGTGATTTTGATACTGGCAGGACT CCATCATCCGATGGTGAACCATAG
AA sequence Show only first row Show all	>Potri.001G040884.1 pacid=42789137 polypeptide=Potri.001G040884.1.p locus=Potri.001G040884 ID=Potri.001G040884.1.v4.1 annot-version=v4.1 MLMEDNRLSDILDARVKEGCQNEEVISVANLAKRCLNLNGKNRPTMREVTSELERIIGLSQEELNIQENCKISENTMDDASNDWDAVSTSITGDFDTGRT PSSDGEP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79670		WAKL22, RFO1	RESISTANCE TO FUSARIUM OXYSPOR...		Potri.001G040884 [exp]	0	1
AT1G79670		WAKL22, RFO1	RESISTANCE TO FUSARIUM OXYSPOR...		Potri.001G040000 [exp]	3.87	0.9112
AT1G79670		WAKL22, RFO1	RESISTANCE TO FUSARIUM OXYSPOR...		Potri.001G041012 [exp]	4.47	0.9016
AT1G69230		SP1L2	SPIRAL1-like2 (.1.2)		Potri.017G095200 [exp]	10.00	0.9109
AT5G61480		PXY, TDR	TDIF receptor, PHLOEM INTERCAL...		Potri.003G107600 [exp]	12.24	0.8995
AT3G24060			Plant self-incompatibility pro...		Potri.003G175200 [exp]	13.74	0.8877
AT4G24760			alpha/beta-Hydrolases superfam...		Potri.012G090800 [exp]	16.24	0.8781
AT1G15320			unknown protein		Potri.001G202300 [exp]	23.23	0.8581
AT2G21100			Disease resistance-responsive ...		Potri.009G131000 [exp]	27.05	0.8027
AT3G55990		TBL29, ESK1	TRICHOME BIREFRINGENCE-LIKE 29...		Potri.008G069950 [exp]	29.29	0.8417
AT3G11590			unknown protein		Potri.016G074300 [exp]	30.01	0.8651

Compare expression of checked genes

Potri.001G040884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.