Plant FIBer expression Database

Potri.001G042800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G042800.2 pacid=42793351 polypeptide=Potri.001G042800.2.p locus=Potri.001G042800 ID=Potri.001G042800.2.v4.1 annot-version=v4.1
ATGAAGGTTAAGTTTCTAGCTTGGACTTTCTCCATCTTCTTATGTAGCATGGCCCTTCATCGAGTTACATCCACGCCACAACATGAAGATTTCGACAAGC
CAGAACCTCTTATGCAAGGACAAGTTCACGATCTAGAAGGCAAGATCGGTTTGTCTAGAGAAGGTGAAAGAAGAGAATACAAGGGAAAGCATGAGATTTT
TCACTCAATAAAGGGACAGAAAGGAAAGGGGGCTTATGGCGGTGCAAATATTGTCCATCGGCCTAAGCACGGGGGAAGAAGTGATGCCTTATTGTCAGCA
AAGGCTAGCAGCTTTGTGACAGCCACTATGTTGTGTGTGAGCTTGGCTTTCATTCTCATATTTCCTTTTCTATAG
AA sequence
>Potri.001G042800.2 pacid=42793351 polypeptide=Potri.001G042800.2.p locus=Potri.001G042800 ID=Potri.001G042800.2.v4.1 annot-version=v4.1
MKVKFLAWTFSIFLCSMALHRVTSTPQHEDFDKPEPLMQGQVHDLEGKIGLSREGERREYKGKHEIFHSIKGQKGKGAYGGANIVHRPKHGGRSDALLSA
KASSFVTATMLCVSLAFILIFPFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G042800
[exp]
0 1
AT4G10270 Wound-responsive family protei... Potri.019G116600
[exp]
4.24 0.8174
AT1G79220 Mitochondrial transcription te... Potri.007G069100
[exp]
5.47 0.8447
AT4G10270 Wound-responsive family protei... Potri.019G116800
[exp]
9.48 0.8019
AT3G58180 ARM repeat superfamily protein... Potri.002G041400
[exp]
11.31 0.7856
AT4G01500 B3 NGA4 NGATHA4, AP2/B3-like transcrip... Potri.015G014850
[exp]
11.48 0.7768
AT4G22140 EBS EARLY BOLTING IN SHORT DAYS, P... Potri.002G226000
[exp]
12.32 0.8231
AT1G71210 Pentatricopeptide repeat (PPR)... Potri.003G000601
[exp]
20.12 0.7838
AT5G41010 NRPE12, NRPD12,... DNA directed RNA polymerase, 7... Potri.011G144800
[exp]
21.90 0.7703
AT1G62390 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1,... Potri.004G002900
[exp]
23.66 0.8150
AT5G15570 Bromodomain transcription fact... Potri.004G116200
[exp]
25.49 0.7557

Potri.001G042800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.