Potri.001G044200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80860 280 / 5e-98 ATPLMT ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G182400 221 / 1e-75 AT1G80860 208 / 1e-70 ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026087 259 / 8e-90 AT1G80860 262 / 5e-91 ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G044200.1 pacid=42793073 polypeptide=Potri.001G044200.1.p locus=Potri.001G044200 ID=Potri.001G044200.1.v4.1 annot-version=v4.1
ATGGGTGTCTTTGCAGCAGTAGGGGTGTTGCTTCCCTTCCCGTATTACTACTGGCTATGGACAAACCCACAAGCATGGGTGAATCTATGTGGGAAAGACA
AGAACCCATCAAAGGTTATGTCTCATGTTTCACATTTCCTCAAGTTGTTGCAGTTCATTTCTCTTTTTTCAGTTTCCACTCTCTCTTGGCCTCCTCCTCT
CTACTTCTGGCCCCTCTTTGGCTTTGGTCAGTTCCTCAACTTCAGGGTATACCAATTGCTTGGTGAATCCGGTACGTACTATGGTGTACGCTTTGGGAAG
AACATCCCTTGGGTGACACAGTTCCCATTCGGGGTTATACAAGATCCACAATATGTTGGAAGCATTTTGAGTCTTTTTGCATGCCTATCTTGGACCCCTT
TCCAATACATTCTCTTGTGGACTCTGGGCTATGTATTCATGATCTATGTGGAATCAAAAGAGGATCCAGCTACTCGAGCAAAGCCAATATCTTGA
AA sequence
>Potri.001G044200.1 pacid=42793073 polypeptide=Potri.001G044200.1.p locus=Potri.001G044200 ID=Potri.001G044200.1.v4.1 annot-version=v4.1
MGVFAAVGVLLPFPYYYWLWTNPQAWVNLCGKDKNPSKVMSHVSHFLKLLQFISLFSVSTLSWPPPLYFWPLFGFGQFLNFRVYQLLGESGTYYGVRFGK
NIPWVTQFPFGVIQDPQYVGSILSLFACLSWTPFQYILLWTLGYVFMIYVESKEDPATRAKPIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G80860 ATPLMT ARABIDOPSIS PHOSPHOLIPID N-MET... Potri.001G044200 0 1
AT1G29330 ATERD2, AERD2, ... ARABIDOPSIS THALIANA ENDOPLASM... Potri.011G071200 2.00 0.6893 Pt-ERD2.1
AT4G32960 unknown protein Potri.018G061800 4.24 0.6664
AT1G10865 unknown protein Potri.008G010300 4.69 0.6858
AT2G26680 unknown protein Potri.014G017900 10.81 0.6560
AT2G31140 Peptidase S24/S26A/S26B/S26C f... Potri.005G225100 11.22 0.6654
AT1G12400 Nucleotide excision repair, TF... Potri.009G138800 17.32 0.6768
AT3G58600 Adaptin ear-binding coat-assoc... Potri.019G089800 31.93 0.6096
AT2G44520 COX10 cytochrome c oxidase 10 (.1) Potri.002G216100 32.00 0.6211
AT1G73820 Ssu72-like family protein (.1) Potri.015G036600 38.36 0.6017
AT5G19630 alpha/beta-Hydrolases superfam... Potri.001G013700 41.25 0.5739

Potri.001G044200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.