Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15970 67 / 3e-14 DNA glycosylase superfamily protein (.1) AT1G80850 66 / 9e-14 DNA glycosylase superfamily protein (.1) AT1G13635 64 / 5e-13 DNA glycosylase superfamily protein (.1.2) AT5G57970 61 / 5e-12 DNA glycosylase superfamily protein (.1.2) AT5G44680 58 / 7e-11 DNA glycosylase superfamily protein (.1) AT1G75090 57 / 8e-11 DNA glycosylase superfamily protein (.1) AT3G12710 55 / 6e-10 DNA glycosylase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G182300 [exp] 87 / 1e-21 AT5G57970 286 / 1e-94 DNA glycosylase superfamily protein (.1.2) Potri.018G106900 [exp] 70 / 4e-15 AT5G57970 418 / 2e-146 DNA glycosylase superfamily protein (.1.2) Potri.006G184700 [exp] 67 / 6e-14 AT5G57970 473 / 8e-168 DNA glycosylase superfamily protein (.1.2) Potri.003G156500 [exp] 60 / 1e-11 AT5G44680 370 / 8e-127 DNA glycosylase superfamily protein (.1) Potri.001G074700 [exp] 59 / 3e-11 AT5G44680 395 / 7e-137 DNA glycosylase superfamily protein (.1) Potri.010G137300 [exp] 58 / 7e-11 AT1G13635 380 / 7e-133 DNA glycosylase superfamily protein (.1.2) Potri.008G112300 [exp] 58 / 8e-11 AT1G13635 372 / 9e-130 DNA glycosylase superfamily protein (.1.2) Potri.008G081000 [exp] 56 / 4e-10 AT5G44680 390 / 6e-135 DNA glycosylase superfamily protein (.1) Potri.014G041700 [exp] 56 / 4e-10 AT1G75090 332 / 2e-113 DNA glycosylase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026083 [exp] 80 / 8e-19 AT5G57970 308 / 6e-104 DNA glycosylase superfamily protein (.1.2) Lus10002310 [exp] 80 / 9e-19 AT1G80850 299 / 3e-100 DNA glycosylase superfamily protein (.1) Lus10019198 [exp] 64 / 2e-13 AT1G13635 300 / 4e-103 DNA glycosylase superfamily protein (.1.2) Lus10019199 [exp] 64 / 2e-13 AT1G13635 222 / 2e-71 DNA glycosylase superfamily protein (.1.2) Lus10038388 [exp] 63 / 9e-13 AT5G57970 256 / 6e-84 DNA glycosylase superfamily protein (.1.2) Lus10036835 [exp] 62 / 3e-12 AT1G13635 216 / 2e-69 DNA glycosylase superfamily protein (.1.2) Lus10036248 [exp] 62 / 4e-12 AT5G44680 383 / 4e-133 DNA glycosylase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G044402.1 pacid=42790831 polypeptide=Potri.001G044402.1.p locus=Potri.001G044402 ID=Potri.001G044402.1.v4.1 annot-version=v4.1 ATGAGATGGTCATTTGTTAGTCCAGCCGCTTGCATGAATGAGTATATAGCTGTTGGACCAACACTTCAAAACCCTCTTCTTGCCGTGTCCTTGCTTATGA GCTCTGCTTTTGGAGTCTTGACTGGAACTTGGTGGGAATATCGGAATTGGCTTATGGTTGACAAAGTTCGAGGTGTGTTTAATAAAAGAGCCAAACTCAT CTATGAACTGCAGCATCAACAACAAGCTGCGAGTTTACAGCAGTTTGGAGGTCATGGGTTGGGACAATCTTCAACAATATTATACCGAGCCCAGAGCTTT CTTTACCATGAGTTATTAACAAAAGTCGCAAAAAAAAAGGGAGTCGAATATTAG
AA sequence Show only first row Show all	>Potri.001G044402.1 pacid=42790831 polypeptide=Potri.001G044402.1.p locus=Potri.001G044402 ID=Potri.001G044402.1.v4.1 annot-version=v4.1 MRWSFVSPAACMNEYIAVGPTLQNPLLAVSLLMSSAFGVLTGTWWEYRNWLMVDKVRGVFNKRAKLIYELQHQQQAASLQQFGGHGLGQSSTILYRAQSF LYHELLTKVAKKKGVEY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57970			DNA glycosylase superfamily pr...		Potri.001G044402 [exp]	0	1
AT1G03940			HXXXD-type acyl-transferase fa...		Potri.019G118000 [exp]	1.41	0.9071
AT2G35215			unknown protein		Potri.001G142250 [exp]	2.23	0.9003
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Potri.006G176800 [exp]	3.46	0.9024
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Potri.006G151600 [exp]	3.74	0.8538	ACO5
AT4G37530			Peroxidase superfamily protein...		Potri.001G329200 [exp]	4.24	0.8975
AT1G43760			DNAse I-like superfamily prote...		Potri.005G151275 [exp]	7.93	0.8787
					Potri.010G072501 [exp]	8.36	0.8787
AT1G21460		SWEET1, AtSWEET...	Nodulin MtN3 family protein (....		Potri.002G072800 [exp]	10.39	0.7810
AT1G62420			Protein of unknown function (D...		Potri.011G023301 [exp]	10.58	0.7782
AT5G24580			Heavy metal transport/detoxifi...		Potri.015G003900 [exp]	10.67	0.8164

Compare expression of checked genes

Potri.001G044402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.