Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29280 40 / 1e-05 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29300 39 / 5e-05 LCR27 low-molecular-weight cysteine-rich 27 (.1) AT4G09153 37 / 0.0002 LCR36 low-molecular-weight cysteine-rich 36 (.1) AT4G29283 37 / 0.0003 LCR21 low-molecular-weight cysteine-rich 21 (.1) AT4G29305 36 / 0.0003 LCR25 low-molecular-weight cysteine-rich 25 (.1) AT4G29290 35 / 0.0008 LCR26 low-molecular-weight cysteine-rich 26 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G061600 [exp] 41 / 3e-06 AT3G61172 54 / 4e-11 low-molecular-weight cysteine-rich 8 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [poplar] [flax] Knottin_1 PF07333 [poplar] [flax] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Potri.001G044800.1 pacid=42787755 polypeptide=Potri.001G044800.1.p locus=Potri.001G044800 ID=Potri.001G044800.1.v4.1 annot-version=v4.1 ATGGCTAGGTTTTCTGGCTACTATATCTTCATCGTTCTTCTTGTCTTCCCAGTTGCATGGACAGTGCCTCGAGCAGAAGCAAAAATATGCTATAACATAA TTCCTAACATTGCTCCATGCAACCCTGGCGGCTGTGGGAGGCTGTGCAAGTTTTTACACTACGAGAAGGGAGAGTGCTCTCCTATGCTGCCAAGCGGAGA GATCCGTTGCAAGTGCAGCTGGACATGTAAATTAACGAACAATCTGCCTCATCAGTTTTACAAGCATTAA
AA sequence Show only first row Show all	>Potri.001G044800.1 pacid=42787755 polypeptide=Potri.001G044800.1.p locus=Potri.001G044800 ID=Potri.001G044800.1.v4.1 annot-version=v4.1 MARFSGYYIFIVLLVFPVAWTVPRAEAKICYNIIPNIAPCNPGGCGRLCKFLHYEKGECSPMLPSGEIRCKCSWTCKLTNNLPHQFYKH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29280		LCR22	low-molecular-weight cysteine-...		Potri.001G044800 [exp]	0	1
					Potri.002G184550 [exp]	4.89	0.9998
AT1G80100		AHP6	histidine phosphotransfer prot...		Potri.003G032400 [exp]	7.74	0.9998
AT3G23560		ALF5	ABERRANT LATERAL ROOT FORMATIO...		Potri.011G117200 [exp]	9.79	0.9998
					Potri.011G073141 [exp]	10.39	0.9998
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Potri.019G046201 [exp]	12.00	0.9997
AT3G23550			MATE efflux family protein (.1...		Potri.011G117400 [exp]	13.67	0.9997
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Potri.009G152300 [exp]	15.49	0.9980
AT4G24340			Phosphorylase superfamily prot...		Potri.019G050200 [exp]	16.12	0.9996
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Potri.009G151900 [exp]	16.61	0.9982
AT3G25830		ATTPS-CIN	"terpene synthase-like sequenc...		Potri.019G022338 [exp]	16.91	0.9992

Compare expression of checked genes

Potri.001G044800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.