Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15950 227 / 6e-75 IRX4, ATCCR1, CCR1 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) AT1G80820 203 / 7e-66 CCR2, ATCCR2 cinnamoyl coa reductase (.1) AT2G33590 141 / 1e-41 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G02400 128 / 8e-37 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09510 128 / 1e-36 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G19440 126 / 5e-36 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G66800 122 / 1e-34 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G51410 120 / 1e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G42800 121 / 2e-33 M318, TT3, DFR dihydroflavonol 4-reductase (.1) AT5G58490 119 / 4e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G046100 [exp] 278 / 4e-95 AT1G15950 511 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G046400 [exp] 276 / 1e-94 AT1G15950 510 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G045500 [exp] 272 / 8e-93 AT1G15950 505 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G045800 [exp] 270 / 8e-93 AT1G15950 350 / 1e-121 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G045000 [exp] 266 / 2e-90 AT1G15950 484 / 3e-173 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G045100 [exp] 263 / 3e-89 AT1G15950 483 / 9e-173 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.003G181400 [exp] 253 / 2e-85 AT1G15950 503 / 1e-180 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.005G257700 [exp] 144 / 3e-42 AT2G33590 400 / 4e-139 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G004500 [exp] 135 / 1e-39 AT2G33590 364 / 2e-126 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041651 [exp] 254 / 2e-85 AT1G15950 532 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10024068 [exp] 249 / 7e-82 AT1G15950 534 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10035369 [exp] 217 / 7e-71 AT1G15950 456 / 6e-162 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10030973 [exp] 214 / 9e-70 AT1G15950 457 / 1e-162 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10012930 [exp] 137 / 2e-40 AT2G33590 360 / 1e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10039595 [exp] 128 / 1e-36 AT5G19440 462 / 6e-165 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10026385 [exp] 128 / 2e-36 AT5G58490 533 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10009955 [exp] 128 / 2e-36 AT1G51410 548 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024138 [exp] 127 / 4e-36 AT2G33590 420 / 2e-148 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10008668 [exp] 125 / 2e-35 AT5G19440 388 / 9e-136 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF01370 [poplar] [flax] Epimerase NAD dependent epimerase/dehydratase family
Representative CDS sequence Show only first row Show all	>Potri.001G045600.1 pacid=42793666 polypeptide=Potri.001G045650.1.p locus=Potri.001G045600 ID=Potri.001G045600.1.v4.1 annot-version=v4.1 ATGCCTGTCGATACTTCATCACTTCCATGCCAAGGCCAAACTGTCTGTGTCACCGGGGCTGGTGGCTTCATTGCTTCATGGATTGTTAAACTTCTTCTAG AGAAAGGTTACTCTGTTAAAGGAACTGTGAGGAACCCAGATTGTGTTAATTTAATGCTCTGTATTTGTGCTGATCTCCTTGATTATGAGTCTCTTAAAGA GGCTATTCAAGGGTGTGATGGAGTTTTCCATACTGCTTCTCCTGTCACAGACGATCCAGAGCAAATGCTGGAGCCAGCAGTGAATGGAACCAAGAATGTG ATCATGGCAGCAGCTGAGGCCAAAGTCCGACGAGTGGTTTTCACGTCTTCAATTGGTACTGTGTACATGGACCCCAATAGGAGCCCTGATGTTGTCGTTG ATGAATCTTGCTGGAGTGATCTTGAGTTCTGCAAGAACACCAAGGTATTTAATTAA
AA sequence Show only first row Show all	>Potri.001G045600.1 pacid=42793666 polypeptide=Potri.001G045650.1.p locus=Potri.001G045600 ID=Potri.001G045600.1.v4.1 annot-version=v4.1 MPVDTSSLPCQGQTVCVTGAGGFIASWIVKLLLEKGYSVKGTVRNPDCVNLMLCICADLLDYESLKEAIQGCDGVFHTASPVTDDPEQMLEPAVNGTKNV IMAAAEAKVRRVVFTSSIGTVYMDPNRSPDVVVDESCWSDLEFCKNTKVFN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Potri.001G045600 [exp]	0	1
					Potri.001G045301 [exp]	1.00	0.9928
AT4G23050			PAS domain-containing protein ...		Potri.001G108900 [exp]	2.00	0.9816
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.011G037600 [exp]	5.47	0.9813
AT4G06744			Leucine-rich repeat (LRR) fami...		Potri.001G302500 [exp]	6.00	0.9794
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Potri.001G046400 [exp]	7.21	0.9791
AT3G20340			unknown protein		Potri.011G003100 [exp]	10.86	0.9694
					Potri.001G045901 [exp]	11.22	0.9666
AT3G11840		PUB24	plant U-box 24 (.1)		Potri.009G016100 [exp]	12.00	0.9820
AT5G37490			ARM repeat superfamily protein...		Potri.012G042600 [exp]	12.32	0.9768
AT5G25880		ATNADP-ME3	Arabidopsis thaliana NADP-mali...		Potri.006G236500 [exp]	15.32	0.9744

Compare expression of checked genes

Potri.001G045600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.