Potri.001G048400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G179600 260 / 4e-89 ND /
Potri.002G242400 52 / 4e-08 AT1G06980 45 / 9e-06 unknown protein
Potri.010G046225 39 / 0.001 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025927 64 / 1e-12 AT1G06980 43 / 4e-05 unknown protein
Lus10002327 61 / 1e-11 AT1G29195 47 / 1e-06 unknown protein
Lus10026092 59 / 9e-11 ND 42 / 5e-05
Lus10038171 56 / 7e-10 AT1G06980 46 / 2e-06 unknown protein
Lus10020386 45 / 8e-06 AT1G06980 44 / 3e-05 unknown protein
Lus10009561 40 / 0.0003 AT1G06980 44 / 1e-05 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF14009 DUF4228 Domain of unknown function (DUF4228)
Representative CDS sequence
>Potri.001G048400.2 pacid=42788803 polypeptide=Potri.001G048400.2.p locus=Potri.001G048400 ID=Potri.001G048400.2.v4.1 annot-version=v4.1
ATGGTAATATCAAGTTCGATCCCCACTAAAAGCACCAAGAACATGCCTTTTAAGATTGTTCATCCTGGAGGTCACATAGAGCTCCATGATAAGCCTGTTC
TTGCAGCAGAGGTCATGCTTTGTAATCCAAGATGCATAGTCGCCTATCCACATGTGTTCCAGCAGCCTTGGGCTATCGCCGGACACCATGCTACTGCTTG
GTCAGAACGCAAGTCCATCAAATATTCTCAATCTCCAATCAATGATGTCCAAGCCAGCAAGACCCCTAGAAATGATGAAAGGGGCTGTCGCATCCCATCC
ACTTGCTGGTTTTTTATCAACAAGAACATGAAGTCACCGAGTCCTTGCTTACATAGAGAAGATGAGAGAGCAAACACCACAGGAACTAATATCAAGAGTA
AAGCCAACAGCACTGTGGAAACAAAAACATCAAGCAGCAGCTGGTGTTCTGGTACCAAGGGGCTTGCCAGGAAGAGAAATAAGGAGATGACAACAGGATC
ACCCAACAGATTTGCATCTCTTGATCGTTGGCAACCAAATCTAGACAGCATTGTAGAAGAATACGAAAACAGTTAA
AA sequence
>Potri.001G048400.2 pacid=42788803 polypeptide=Potri.001G048400.2.p locus=Potri.001G048400 ID=Potri.001G048400.2.v4.1 annot-version=v4.1
MVISSSIPTKSTKNMPFKIVHPGGHIELHDKPVLAAEVMLCNPRCIVAYPHVFQQPWAIAGHHATAWSERKSIKYSQSPINDVQASKTPRNDERGCRIPS
TCWFFINKNMKSPSPCLHREDERANTTGTNIKSKANSTVETKTSSSSWCSGTKGLARKRNKEMTTGSPNRFASLDRWQPNLDSIVEEYENS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G048400 0 1
Potri.001G027950 2.00 0.8863
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Potri.014G179400 3.00 0.9054
AT5G23370 GRAM domain-containing protein... Potri.005G088400 6.00 0.8338
Potri.010G007899 8.48 0.8460
AT5G23370 GRAM domain-containing protein... Potri.005G088300 9.79 0.8506
Potri.019G001604 10.19 0.8269
AT5G63060 Sec14p-like phosphatidylinosit... Potri.012G088350 10.24 0.8777
AT1G21910 AP2_ERF DREB26 dehydration response element-b... Potri.005G176000 12.24 0.8591 DREB39
AT3G25400 unknown protein Potri.014G148200 15.49 0.8037
AT3G22910 ATPase E1-E2 type family prote... Potri.016G009101 16.91 0.8433

Potri.001G048400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.