Plant FIBer expression Database

Potri.001G051300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34010 42 / 2e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G177200
[exp]
139 / 3e-44 AT1G34010 48 / 7e-08 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G051300.3 pacid=42788619 polypeptide=Potri.001G051300.3.p locus=Potri.001G051300 ID=Potri.001G051300.3.v4.1 annot-version=v4.1
ATGGAAGAAGCCAGTAATAATGATTCAGTACAAGATCATCAAATGAGCAATGGTGGGAGAAATATAAGAAGCAGGACTGCTAGTGGGTCTAATAATGGAC
CTCTCTTGGAAACTTCTCCTCTCAAGAGTACTCTCAAGAAAACTACTAATGCTATAGTTGGGGAAAATCAAGCAAGGAAAGATCATCAAAAGAGAAAAGT
CAGTTGGCCTGATATTGCTCATGGAACAGATATTGCTCATGTTCTTGAATTTGAATCAAGCACCTCTGATGATGGAGAACTTGAAGGAGTAAGGAACTCT
TGTGTTTGTACAATTCAGTGA
AA sequence
>Potri.001G051300.3 pacid=42788619 polypeptide=Potri.001G051300.3.p locus=Potri.001G051300 ID=Potri.001G051300.3.v4.1 annot-version=v4.1
MEEASNNDSVQDHQMSNGGRNIRSRTASGSNNGPLLETSPLKSTLKKTTNAIVGENQARKDHQKRKVSWPDIAHGTDIAHVLEFESSTSDDGELEGVRNS
CVCTIQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G051300
[exp]
0 1
AT1G62400 HT1 high leaf temperature 1, Prote... Potri.011G022800
[exp]
4.12 0.7905
AT1G23380 HD KNAT6S, KNAT6L,... KNOTTED1-like homeobox gene 6 ... Potri.005G014200
[exp]
5.09 0.7683
Potri.013G005300
[exp]
6.00 0.7462
AT1G54200 unknown protein Potri.003G063400
[exp]
8.71 0.7568
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.001G032500
[exp]
11.40 0.7316
AT2G25180 GARP ARR12 response regulator 12 (.1) Potri.006G262100
[exp]
13.22 0.7490
AT5G65550 UDP-Glycosyltransferase superf... Potri.008G024900
[exp]
15.23 0.7366
AT3G53690 RING/U-box superfamily protein... Potri.018G064400
[exp]
21.16 0.7431
AT2G28070 ABCG3 ATP-binding cassette G3, ABC-2... Potri.009G008200
[exp]
25.69 0.6853
Potri.008G166566
[exp]
27.11 0.6959

Potri.001G051300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.