Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) AT1G04645 54 / 6e-10 Plant self-incompatibility protein S1 family (.1) AT1G26798 53 / 2e-09 Plant self-incompatibility protein S1 family (.1) AT5G06020 53 / 2e-09 Plant self-incompatibility protein S1 family (.1) AT1G26799 53 / 3e-09 Plant self-incompatibility protein S1 family (.1) AT3G55672 51 / 1e-08 Plant self-incompatibility protein S1 family (.1) AT3G55665 48 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT5G04350 48 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT5G06030 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT4G16195 47 / 3e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G175200 [exp] 257 / 9e-90 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 75 / 6e-18 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 71 / 3e-16 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 69 / 2e-15 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.001G053200 [exp] 57 / 4e-11 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 56 / 3e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.003G175100 [exp] 54 / 6e-10 ND / Potri.002G263900 [exp] 53 / 1e-09 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1) Potri.003G175000 [exp] 50 / 2e-08 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023675 [exp] 203 / 3e-68 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10011754 [exp] 179 / 3e-59 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1) Lus10017719 [exp] 174 / 5e-57 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1) Lus10033675 [exp] 83 / 2e-21 AT3G24060 72 / 4e-17 Plant self-incompatibility protein S1 family (.1) Lus10030565 [exp] 64 / 2e-13 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1) Lus10008107 [exp] 49 / 8e-08 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1) Lus10030964 [exp] 48 / 1e-07 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1) Lus10030965 [exp] 48 / 2e-07 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10013145 [exp] 48 / 2e-07 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1) Lus10038163 [exp] 45 / 1e-06 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [poplar] [flax] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Potri.001G053100.1 pacid=42792286 polypeptide=Potri.001G053100.1.p locus=Potri.001G053100 ID=Potri.001G053100.1.v4.1 annot-version=v4.1 ATGAAGGTTCTCACTAAGATTTTTCTTGTAGTTAGCCTCGCCATAGGCATGATTTTCATGTCAATATATCAACCAGAATATTTCTGTGGGCTAGAGTACG ATGTTCGTGTCATCAATGGGTTCACAAACAACTCATCACTGCCACTAGTCATATGGTGCTCATCAGACAGTGATGATCTCGGTGGACGTGCCCTCCAGGA AGGTGATGATTTTAGTTGGAGACTCCAGATCAACTTCTGGTGCAGTAATCATTTCCGGTGCACCATGAAGTGGGATGCAATGAGGAGGAAGTTCGATGCC TTTAAGGTTCCAAGGGATCTTCAGCGTTGCAGCCCTTTCAGGATGTGCTCTTGGTTGGTGAGAGAGGATGGGTTTTATTTCAGTAATGATGAAGTAAACT GGAAGAAAGACTTCTCATGGTTATAA
AA sequence Show only first row Show all	>Potri.001G053100.1 pacid=42792286 polypeptide=Potri.001G053100.1.p locus=Potri.001G053100 ID=Potri.001G053100.1.v4.1 annot-version=v4.1 MKVLTKIFLVVSLAIGMIFMSIYQPEYFCGLEYDVRVINGFTNNSSLPLVIWCSSDSDDLGGRALQEGDDFSWRLQINFWCSNHFRCTMKWDAMRRKFDA FKVPRDLQRCSPFRMCSWLVREDGFYFSNDEVNWKKDFSWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24060			Plant self-incompatibility pro...		Potri.001G053100 [exp]	0	1
					Potri.003G217600 [exp]	1.00	0.9660
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.006G045300 [exp]	10.67	0.9313
					Potri.003G138700 [exp]	12.24	0.9179
AT2G34700			Pollen Ole e 1 allergen and ex...		Potri.004G044700 [exp]	14.45	0.8929
AT3G03430			Calcium-binding EF-hand family...		Potri.014G030800 [exp]	19.87	0.9107
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.017G118700 [exp]	21.56	0.7841
AT4G03965			RING/U-box superfamily protein...		Potri.011G020800 [exp]	21.65	0.9057
AT3G06240			F-box family protein (.1)		Potri.017G058900 [exp]	22.80	0.9041
AT3G62290		ATARFA1E	ADP-ribosylation factor A1E (....		Potri.001G301200 [exp]	26.38	0.9066
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Potri.002G014900 [exp]	30.14	0.8991

Compare expression of checked genes

Potri.001G053100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.