Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24060 56 / 2e-10 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G175000 [exp] 198 / 8e-67 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1) Potri.003G175100 [exp] 133 / 4e-41 ND / Potri.002G263900 [exp] 123 / 4e-37 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 59 / 1e-11 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 57 / 3e-11 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 57 / 6e-11 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 40 / 8e-05 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011754 [exp] 59 / 4e-12 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1) Lus10023675 [exp] 56 / 2e-10 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10017719 [exp] 50 / 1e-08 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1) Lus10000682 [exp] 42 / 3e-05 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1) Lus10021633 [exp] 41 / 4e-05 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10025935 [exp] 41 / 4e-05 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1) Lus10038163 [exp] 41 / 6e-05 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1) Lus10038164 [exp] 40 / 7e-05 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1) Lus10016171 [exp] 40 / 0.0001 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1) Lus10016350 [exp] 40 / 0.0001 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [poplar] [flax] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Potri.001G053200.1 pacid=42792822 polypeptide=Potri.001G053200.1.p locus=Potri.001G053200 ID=Potri.001G053200.1.v4.1 annot-version=v4.1 ATGACTGGTTTTATCAGCTTTCTTCTCTTCCTTGTTCTCCCACTGTGCCTTCTGAGCACTGCAACAGCAGATGAACATGATGAGCATCGTCTACCCTTTG TTCAAGTTATCAATGCCTTGCCTAAAAACTCAAAACCAATGCAAGTTAGCTGTTCAACCAAAAACATTAACATCGGAAAGCGCTCTCTTGTTAATGGTGA AGTCTTCAAATGGAGGGCGGCACAGAGAAAGCTACATTCCTGTGGAGCTTTATGGGAAAGACTTTTTGCATCCTGGCATGCATTTCAACCTCGCAGGGAT GAGAATCATGAAACTGTGTATTGGATGGTGAAGGAAGATGGGTTCTTCATTAGCTGGGACAAAGCCAACTGGGTGAGAAAATATAGATGGGAAACCGAGT GA
AA sequence Show only first row Show all	>Potri.001G053200.1 pacid=42792822 polypeptide=Potri.001G053200.1.p locus=Potri.001G053200 ID=Potri.001G053200.1.v4.1 annot-version=v4.1 MTGFISFLLFLVLPLCLLSTATADEHDEHRLPFVQVINALPKNSKPMQVSCSTKNINIGKRSLVNGEVFKWRAAQRKLHSCGALWERLFASWHAFQPRRD ENHETVYWMVKEDGFFISWDKANWVRKYRWETE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24060			Plant self-incompatibility pro...		Potri.001G053200 [exp]	0	1
AT4G08330			unknown protein		Potri.005G178000 [exp]	2.00	0.8455
AT2G31940			unknown protein		Potri.009G024500 [exp]	3.16	0.8277
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.015G102100 [exp]	4.12	0.8987
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Potri.015G074300 [exp]	6.78	0.7925
AT3G21510		ATHP3, AHP1	histidine-containing phosphotr...		Potri.005G040400 [exp]	7.34	0.8162	Pt-HPT2.3
					Potri.010G171166 [exp]	10.00	0.7046
AT2G25737			Sulfite exporter TauE/SafE fam...		Potri.018G037400 [exp]	11.48	0.8790
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Potri.009G068000 [exp]	15.00	0.7904
AT2G20390			unknown protein		Potri.014G193150 [exp]	15.49	0.7914
					Potri.015G107050 [exp]	28.16	0.7510

Compare expression of checked genes

Potri.001G053200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.