Pt-TOM20.1 (Potri.001G054900) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TOM20.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27390 230 / 4e-77 TOM20-2 translocase outer membrane 20-2 (.1)
AT3G27080 220 / 3e-73 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT5G40930 194 / 3e-63 TOM20-4 translocase of outer membrane 20-4 (.1)
AT3G27070 169 / 1e-53 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G173400 345 / 1e-122 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Potri.001G330200 241 / 9e-82 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012532 255 / 2e-80 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10035211 226 / 5e-75 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10032045 224 / 3e-74 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10011363 179 / 4e-57 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10006419 174 / 4e-55 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 84 / 3e-20 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Potri.001G054900.1 pacid=42790781 polypeptide=Potri.001G054900.1.p locus=Potri.001G054900 ID=Potri.001G054900.1.v4.1 annot-version=v4.1
ATGGAGTTCTCTCAAGATGACTTCGATCGTCTCTTAATGTTCGAGCACGCTCGTAAAACCGCTGAAGCTACCTACGCTAGAGACCCTCTCGATGCCACAA
ACTTGACTAAGTGGGGTGAGGCATTGCTGGAATTATCGCAATTTCAAACTGTGGCAGAGGCAAAGAAGATGATAAATGATGCCATTTCAAAGTTGGAAGA
GGCATTGATGTTAAATCCAACATCCAATGCCATGTGGTCTATAGGAAATGCCAATACTTCTTATGCATTTCTGACTCCTGATCTTGACGAAGCTAAAAGT
TATTTCGACAAGGCAGCTAATTATTTCCAACAAGCAGTTGATGAGGATCCAAACAACGAGCTTTATCGTAAGTCTTTGGAAGTTTGCGCTAAGGCTCCAG
AATTACATACGGAGATCCATAAGCATTCAAGCAGTCAACAGATTATGGGTGGGGGGGGTTCTACTGCTTCTTCAAATGCAAAGGGCTCCAAGAAGAAGAC
AAACAGTGATCTGAAGTATGATATATTTGGATGGATTATCCTTGCAGTTGGCATCGTTGCTTGGGTGGGGATGGCGAAATCCAATGTTCCTCCTCCTCCA
AGATAA
AA sequence
>Potri.001G054900.1 pacid=42790781 polypeptide=Potri.001G054900.1.p locus=Potri.001G054900 ID=Potri.001G054900.1.v4.1 annot-version=v4.1
MEFSQDDFDRLLMFEHARKTAEATYARDPLDATNLTKWGEALLELSQFQTVAEAKKMINDAISKLEEALMLNPTSNAMWSIGNANTSYAFLTPDLDEAKS
YFDKAANYFQQAVDEDPNNELYRKSLEVCAKAPELHTEIHKHSSSQQIMGGGGSTASSNAKGSKKKTNSDLKYDIFGWIILAVGIVAWVGMAKSNVPPPP
R

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27390 TOM20-2 translocase outer membrane 20-... Potri.001G054900 0 1 Pt-TOM20.1
AT1G03330 Small nuclear ribonucleoprotei... Potri.004G219000 1.41 0.8399
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Potri.010G084800 2.64 0.8221 PBD2.2
AT5G06360 Ribosomal protein S8e family p... Potri.006G203400 2.82 0.8279
AT5G46160 Ribosomal protein L14p/L23e fa... Potri.010G022800 3.87 0.8268 RPL14.1
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Potri.016G087900 4.47 0.8156
AT5G11170 DEAD/DEAH box RNA helicase fam... Potri.006G253100 4.58 0.8464
AT1G09810 ECT11 evolutionarily conserved C-ter... Potri.004G223800 7.14 0.7910
AT5G64680 unknown protein Potri.001G068500 11.48 0.8120
AT5G11170 DEAD/DEAH box RNA helicase fam... Potri.018G028600 12.36 0.8283
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.017G101200 14.38 0.7790

Potri.001G054900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.