Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51920 59 / 1e-10 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) AT5G66950 59 / 2e-10 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) AT4G37100 56 / 2e-09 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) AT2G23520 56 / 3e-09 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G172100 [exp] 240 / 2e-79 AT5G51920 91 / 1e-19 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.015G097000 [exp] 213 / 5e-69 AT4G37100 97 / 9e-22 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.012G098200 [exp] 209 / 1e-67 AT4G37100 95 / 4e-21 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.003G120500 [exp] 60 / 9e-11 AT5G51920 487 / 3e-166 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.015G137900 [exp] 58 / 3e-10 AT5G51920 464 / 3e-157 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.001G111600 [exp] 57 / 9e-10 AT4G22980 431 / 2e-144 unknown protein Potri.007G036100 [exp] 56 / 3e-09 AT2G23520 1236 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.005G131300 [exp] 55 / 5e-09 AT2G23520 1227 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037025 [exp] 205 / 5e-66 AT5G51920 86 / 3e-18 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10022447 [exp] 203 / 2e-65 AT2G23520 96 / 1e-21 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10015781 [exp] 206 / 8e-65 AT1G27385 168 / 1e-49 unknown protein Lus10016752 [exp] 203 / 1e-64 AT2G23520 96 / 5e-21 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10006342 [exp] 62 / 2e-11 AT5G51920 432 / 4e-144 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10002958 [exp] 60 / 1e-10 AT5G51920 396 / 5e-130 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10022472 [exp] 59 / 2e-10 AT2G23520 1238 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10016776 [exp] 59 / 2e-10 AT2G23520 1229 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10038892 [exp] 59 / 3e-10 AT5G51920 578 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10019650 [exp] 56 / 2e-09 AT4G37100 1186 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G056400.2 pacid=42792387 polypeptide=Potri.001G056400.2.p locus=Potri.001G056400 ID=Potri.001G056400.2.v4.1 annot-version=v4.1 ATGGAGAAAACACAATTGATCTTACTAATCTTTGCATCAATGAGGAATCGTCCAGAACCACACCGGACAGTAAGCCTGGTTCCCCAAAGAGTCTTGGCGC TAGAGAGTGTACTCCATTCACTCGCAGCCTACCTGATATTGACACCGGACGCAATGGGGATGATTGGAGAGAGCTACCCTTTCTTCAGAGGTAATTACTA TATGACAATAATCGGGGAAGAAAATGATACGATACGTGAATTTGCTATTTGTAAAGAATCAAAGGTTATTCCAATGCCAGAAACTTGGCTGAACCTGCGG ATTAAGGGGTCGCAACATAGCCAATTTCTTAGAAGGAAGTGCAAGCACATCCCAAAGGGGCTTTTCTCTTATCCTGCTATTGTCAATGAGACCAGATATT CTATGCATTGGATATCAGAGGCGCACAGAAATTCATGGCGTGCTCTCATTGATGCCACAGGCATGGTTTTTGGAGAAGACAGACTGGCCCTTGCACACCA CCGCCCTGACTTCGTGTTATGTACACTTGCTTAG
AA sequence Show only first row Show all	>Potri.001G056400.2 pacid=42792387 polypeptide=Potri.001G056400.2.p locus=Potri.001G056400 ID=Potri.001G056400.2.v4.1 annot-version=v4.1 MEKTQLILLIFASMRNRPEPHRTVSLVPQRVLALESVLHSLAAYLILTPDAMGMIGESYPFFRGNYYMTIIGEENDTIREFAICKESKVIPMPETWLNLR IKGSQHSQFLRRKCKHIPKGLFSYPAIVNETRYSMHWISEAHRNSWRALIDATGMVFGEDRLALAHHRPDFVLCTLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G51920			Pyridoxal phosphate (PLP)-depe...		Potri.001G056400 [exp]	0	1
AT1G04900			Protein of unknown function (D...		Potri.001G314700 [exp]	3.46	0.7765
AT2G16370		THY-1	thymidylate synthase 1 (.1)		Potri.005G230400 [exp]	3.87	0.8033
AT5G01270		CPL2, ATCPL2	carboxyl-terminal domain (ctd)...		Potri.006G099302 [exp]	6.00	0.8048
AT5G23490			unknown protein		Potri.004G133700 [exp]	6.70	0.7682
AT5G23450		ATLCBK1	long-chain base (LCB) kinase 1...		Potri.008G002100 [exp]	7.34	0.7382
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.019G021200 [exp]	12.64	0.7697
					Potri.008G195401 [exp]	15.36	0.7929
AT5G38830			Cysteinyl-tRNA synthetase, cla...		Potri.008G122901 [exp]	18.89	0.7506
AT4G02210			unknown protein		Potri.002G200600 [exp]	19.89	0.7490
AT3G42670		CLSY1, CLSY, CH...	CLASSY 1, CLASSY1, chromatin r...		Potri.010G183832 [exp]	23.45	0.7663

Compare expression of checked genes

Potri.001G056400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.