Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43260 145 / 4e-47 chaperone protein dnaJ-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G171800 [exp] 168 / 4e-56 AT5G43260 152 / 1e-49 chaperone protein dnaJ-related (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037022 [exp] 124 / 1e-38 AT5G43260 135 / 4e-43 chaperone protein dnaJ-related (.1) Lus10015783 [exp] 124 / 1e-38 AT5G43260 135 / 4e-43 chaperone protein dnaJ-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G056601.1 pacid=42790516 polypeptide=Potri.001G056601.1.p locus=Potri.001G056601 ID=Potri.001G056601.1.v4.1 annot-version=v4.1 ATGGAACCGATCGTTTTGACCCAGTTGGCAACGGGTCTTAGTGTGCTAGCCGGGGCGGTTCTGGTCAAGTCGGTTATGGGCCAGAAGCCCATGGCTGGTC CGACGTGCCCATCTTGCAACGGCACGCGTCGAGTCGCTTGTCTTTGTTCCCGTTGGTCAGACCGAGATGTGGGTTGCCGGACTTGTTCTGGTTCCGGTCG CATGGCGTGTAGTAGCTGCGGCGGGACAGGTACTGGTCGGCCTATTCCGGTTCAAATCTCTATGAGGTCACCAAACCGCCCATCTTGA
AA sequence Show only first row Show all	>Potri.001G056601.1 pacid=42790516 polypeptide=Potri.001G056601.1.p locus=Potri.001G056601 ID=Potri.001G056601.1.v4.1 annot-version=v4.1 MEPIVLTQLATGLSVLAGAVLVKSVMGQKPMAGPTCPSCNGTRRVACLCSRWSDRDVGCRTCSGSGRMACSSCGGTGTGRPIPVQISMRSPNRPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43260			chaperone protein dnaJ-related...		Potri.001G056601 [exp]	0	1
AT5G04250			Cysteine proteinases superfami...		Potri.008G036900 [exp]	3.87	0.9227
AT1G06050			Protein of unknown function (D...		Potri.007G130400 [exp]	5.09	0.9354
AT1G02305			Cysteine proteinases superfami...		Potri.002G184201 [exp]	7.34	0.9289
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Potri.009G095100 [exp]	11.22	0.9032
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Potri.008G128500 [exp]	14.49	0.8787	MYB194
AT3G10190			Calcium-binding EF-hand family...		Potri.016G040900 [exp]	18.00	0.8738
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.010G108800 [exp]	18.13	0.9212
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.014G019300 [exp]	18.49	0.9027
AT2G46870	B3	NGA1	NGATHA1, AP2/B3-like transcrip...		Potri.011G149700 [exp]	19.39	0.9241
AT5G61820			unknown protein		Potri.015G108500 [exp]	20.19	0.9122

Compare expression of checked genes

Potri.001G056601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.