Potri.001G057150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27330 99 / 3e-29 Ribosome associated membrane protein RAMP4 (.1)
AT1G27350 99 / 3e-29 Ribosome associated membrane protein RAMP4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G171100 99 / 2e-29 AT1G27330 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1)
Potri.001G057300 97 / 2e-28 AT1G27330 116 / 3e-36 Ribosome associated membrane protein RAMP4 (.1)
Potri.006G017100 95 / 1e-27 AT1G27330 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1)
Potri.016G008600 86 / 7e-24 AT1G27330 72 / 2e-18 Ribosome associated membrane protein RAMP4 (.1)
Potri.003G171250 67 / 1e-16 AT1G27330 73 / 2e-19 Ribosome associated membrane protein RAMP4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037031 100 / 2e-29 AT1G27350 120 / 6e-38 Ribosome associated membrane protein RAMP4 (.1)
Lus10011355 87 / 3e-24 AT1G27350 108 / 2e-33 Ribosome associated membrane protein RAMP4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06624 RAMP4 Ribosome associated membrane protein RAMP4
Representative CDS sequence
>Potri.001G057150.1 pacid=42793587 polypeptide=Potri.001G057150.1.p locus=Potri.001G057150 ID=Potri.001G057150.1.v4.1 annot-version=v4.1
ATGTTGGTCACTGTTGTAATCATGAATACATCAGGGCATCTTGCTGCTAGGAAAATTGATAGATTTGAGAACTTTACCAAGAGAGGAGCTGTGCCCGAAA
CAACCATGAAAAAGGGAAAGGACTATACTGTTGGTCCTGTTCTCCTTGGATTCTTCATCTTTGTTGTCATTGGATCATCTCTATTCCAGATAATCAGGAC
AGCCACAAGCGAAGGCAAGGCATGA
AA sequence
>Potri.001G057150.1 pacid=42793587 polypeptide=Potri.001G057150.1.p locus=Potri.001G057150 ID=Potri.001G057150.1.v4.1 annot-version=v4.1
MLVTVVIMNTSGHLAARKIDRFENFTKRGAVPETTMKKGKDYTVGPVLLGFFIFVVIGSSLFQIIRTATSEGKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27330 Ribosome associated membrane p... Potri.001G057150 0 1
AT1G26880 Ribosomal protein L34e superfa... Potri.004G029400 4.47 0.9085
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.004G166200 15.19 0.9005
AT5G14030 translocon-associated protein ... Potri.001G323400 15.23 0.9054
AT1G20760 Calcium-binding EF hand family... Potri.002G008300 18.73 0.8952
AT1G36050 Endoplasmic reticulum vesicle ... Potri.002G094400 22.84 0.8964
AT5G04420 Galactose oxidase/kelch repeat... Potri.008G030901 25.69 0.8897
AT5G07610 F-box family protein (.1) Potri.001G146000 26.64 0.8420
AT1G60660 B5 #5, B5#5, AT... ARABIDOPSIS CYTOCHROME B5-LIKE... Potri.018G087600 27.45 0.8781 B5.1
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.011G127250 30.75 0.8905
AT5G56000 Hsp81.4, AtHsp9... HEAT SHOCK PROTEIN 90.4, HEAT ... Potri.011G163932 31.30 0.8819

Potri.001G057150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.