Potri.001G057500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27970 229 / 3e-79 NTF2B nuclear transport factor 2B (.1.2)
AT1G27310 223 / 7e-77 NTF2A nuclear transport factor 2A (.1)
AT1G11570 149 / 2e-47 NTL NTF2-like (.1.2)
AT5G60980 56 / 6e-10 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT1G13730 54 / 2e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT5G48650 54 / 2e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT3G25150 51 / 2e-08 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT2G03640 45 / 3e-06 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G170800 239 / 1e-83 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2)
Potri.011G025500 158 / 7e-51 AT1G11570 171 / 5e-56 NTF2-like (.1.2)
Potri.010G157800 61 / 1e-11 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Potri.008G096700 57 / 1e-10 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Potri.002G246600 57 / 3e-10 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.017G094600 55 / 9e-10 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.015G058700 49 / 8e-08 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.002G257000 44 / 7e-06 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.010G065500 43 / 1e-05 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037033 238 / 7e-83 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2)
Lus10032033 229 / 2e-79 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2)
Lus10015772 188 / 9e-63 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1)
Lus10035202 181 / 2e-60 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1)
Lus10020061 152 / 6e-49 AT1G11570 171 / 3e-56 NTF2-like (.1.2)
Lus10006762 113 / 1e-33 AT1G11570 130 / 2e-40 NTF2-like (.1.2)
Lus10026668 58 / 9e-11 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10004644 58 / 9e-11 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10037066 56 / 8e-10 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10036918 56 / 8e-10 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0051 NTF2 PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence
>Potri.001G057500.6 pacid=42791159 polypeptide=Potri.001G057500.6.p locus=Potri.001G057500 ID=Potri.001G057500.6.v4.1 annot-version=v4.1
ATGGATCCAGACCAAGTAGCAAAGGCGTTTGTTGAGCACTACTATTCTACGTTCGATGCGAACAGAGCTGGATTAGCGAATCTGTATCAAGACGGTTCCA
TGCTTACTTTTGAAGGTCAAAAGACGCAGGGATCCCAGAATATCGTTGCTAAACTTATCGCTCTCCCTTTCCAGCAGTGCAAGCATCTCATCACCACCGT
TGATTGCCAGCCTTCTGGTCCTGCTGGTGGTATGCTTGTTTTTGTCTCCGGTAATCTCCAGCTCGCCGGCGAACAGCATGCTCTCAAGTTCAGCCAGATG
TTCCATTTAATGCCAACTCCACAGGGAAGCTTTTACGTGTTCAATGACATATTCAGGTTGAACTATGCTTGA
AA sequence
>Potri.001G057500.6 pacid=42791159 polypeptide=Potri.001G057500.6.p locus=Potri.001G057500 ID=Potri.001G057500.6.v4.1 annot-version=v4.1
MDPDQVAKAFVEHYYSTFDANRAGLANLYQDGSMLTFEGQKTQGSQNIVAKLIALPFQQCKHLITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQM
FHLMPTPQGSFYVFNDIFRLNYA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.001G057500 0 1
AT5G55640 unknown protein Potri.001G367200 1.73 0.8571
AT1G12390 Cornichon family protein (.1) Potri.003G116400 2.00 0.8663
AT4G21192 Cytochrome c oxidase biogenesi... Potri.004G227500 4.00 0.8441
AT1G69980 unknown protein Potri.008G191700 4.89 0.8370
AT1G77350 unknown protein Potri.019G066600 5.09 0.8876
AT1G77710 unknown protein Potri.002G087200 5.47 0.8481
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Potri.005G221600 8.00 0.7996 BET11.1
AT5G47890 NADH-ubiquinone oxidoreductase... Potri.001G071900 10.58 0.8538
AT4G08455 BTB/POZ domain-containing prot... Potri.005G183600 10.95 0.8030
AT3G51610 NPU NO PRIMEXINE AND PLASMA MEMBRA... Potri.016G134700 11.22 0.8183

Potri.001G057500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.