Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48660 74 / 1e-18 Protein of unknown function (DUF 3339) (.1) AT3G27027 72 / 2e-18 Protein of unknown function (DUF 3339) (.1) AT5G40980 71 / 7e-18 Protein of unknown function (DUF 3339) (.1) AT5G63500 70 / 2e-17 Protein of unknown function (DUF 3339) (.1) AT5G08391 67 / 1e-16 Protein of unknown function (DUF 3339) (.1) AT5G14110 61 / 5e-14 Protein of unknown function (DUF 3339) (.1) AT3G27030 62 / 1e-13 unknown protein AT3G01950 59 / 5e-13 Protein of unknown function (DUF 3339) (.1) AT5G40970 54 / 4e-11 Protein of unknown function (DUF 3339) (.1) AT3G01940 52 / 3e-10 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 83 / 1e-22 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 79 / 5e-21 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 76 / 3e-19 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 74 / 6e-19 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 70 / 2e-17 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 69 / 5e-17 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 68 / 6e-17 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 64 / 2e-15 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 63 / 1e-14 AT3G27030 79 / 2e-20 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037036 [exp] 76 / 8e-20 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 76 / 9e-20 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 75 / 2e-19 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 74 / 4e-19 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 69 / 4e-17 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 69 / 5e-17 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10012543 [exp] 69 / 1e-16 ND 100 / 2e-29 Lus10041550 [exp] 69 / 3e-16 AT3G27030 122 / 8e-37 unknown protein Lus10032029 [exp] 67 / 1e-15 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10012542 [exp] 64 / 3e-15 AT3G27030 113 / 3e-34 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [poplar] [flax] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Potri.001G058001.1 pacid=42787715 polypeptide=Potri.001G058001.1.p locus=Potri.001G058001 ID=Potri.001G058001.1.v4.1 annot-version=v4.1 ATGAGAGTGACGAGAATCAAAATAAAAGGGAATTGGGAAGTCACATCTAATGGCAAAAATGGCAGACTGGGGCCCGTGGTGATAGCAGTGGTGCTGTTTG TGCTGTTGAGTCCAGGATCGCTATTCCAGTTTCCGGGGAGGAGAAGAGTTGTTGAGTTTGGGAACATGCAGACTAGTGGAATAGCGATACTGGTCCATAC CATCATCTTCTTTGGTCTCATAACCATCTTTCTCGTTGTTATTGGTGTTAACATTTACACAGGATAG
AA sequence Show only first row Show all	>Potri.001G058001.1 pacid=42787715 polypeptide=Potri.001G058001.1.p locus=Potri.001G058001 ID=Potri.001G058001.1.v4.1 annot-version=v4.1 MRVTRIKIKGNWEVTSNGKNGRLGPVVIAVVLFVLLSPGSLFQFPGRRRVVEFGNMQTSGIAILVHTIIFFGLITIFLVVIGVNIYTG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48660			Protein of unknown function (D...		Potri.001G058001 [exp]	0	1
AT3G03430			Calcium-binding EF-hand family...		Potri.014G030800 [exp]	1.41	0.9755
					Potri.009G081850 [exp]	3.46	0.9756
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.006G045300 [exp]	4.89	0.9730
AT3G16150		ASPGB1	asparaginase B1, N-terminal nu...		Potri.002G122900 [exp]	6.16	0.9633
AT3G06240			F-box family protein (.1)		Potri.017G058900 [exp]	8.00	0.9681
					Potri.007G034101 [exp]	9.48	0.9716
AT4G08300			nodulin MtN21 /EamA-like trans...		Potri.005G176200 [exp]	11.48	0.9709
					Potri.008G114000 [exp]	12.40	0.9591
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.001G189900 [exp]	12.68	0.9708
					Potri.007G034000 [exp]	13.41	0.9705

Compare expression of checked genes

Potri.001G058001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.