Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13230 146 / 2e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G13650 124 / 8e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G03880 123 / 1e-33 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G02750 120 / 3e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G16470 118 / 4e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G11290 116 / 8e-31 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G32415 116 / 8e-31 pentatricopeptide (PPR) repeat-containing protein (.1) AT5G39680 115 / 2e-30 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G20230 115 / 2e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G05340 114 / 4e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G164900 [exp] 212 / 2e-65 AT5G13230 950 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G181800 [exp] 124 / 2e-33 AT4G30700 1025 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G019900 [exp] 123 / 3e-33 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G191000 [exp] 121 / 8e-33 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G058900 [exp] 119 / 6e-32 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G048800 [exp] 119 / 6e-32 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G217900 [exp] 119 / 8e-32 AT2G22410 530 / 0.0 SLOW GROWTH 1 (.1) Potri.007G050200 [exp] 118 / 1e-31 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G208000 [exp] 117 / 3e-31 AT2G03880 939 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014956 [exp] 174 / 1e-53 AT5G13230 484 / 1e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038839 [exp] 171 / 5e-51 AT5G13230 715 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017446 [exp] 124 / 1e-33 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035815 [exp] 121 / 1e-32 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015898 [exp] 120 / 3e-32 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035788 [exp] 119 / 7e-32 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10009269 [exp] 117 / 4e-31 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037362 [exp] 117 / 4e-31 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003790 [exp] 116 / 6e-31 AT1G17630 659 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10010850 [exp] 115 / 1e-30 AT5G60020 856 / 0.0 laccase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.001G062566.1 pacid=42788167 polypeptide=Potri.001G062566.1.p locus=Potri.001G062566 ID=Potri.001G062566.1.v4.1 annot-version=v4.1 ATGCATGTTCTGGTATTGCTGCCATGGAACCAGACAGACAGTCATTCATTGCTAGTGAAAACTATTTATGACAAGAACACTGTGGTTGGAAATGCTTTGA TAGATATGTATGCCAAGTGTGGAAGCATTAGAGATGCACGTTTAGTGTTTAACATGCTAAGGGAATGTGATCAAGTGTCATGGAGTGCTATGATTGCAGG ATATTCTGTGCACGGGCTATGTAGGGAAGCTCTAAAAGCTTTTGAATTGATGCAGGAAACAGAGTGTAAACCAGACAAGGTAACTTTTGTTGGTATCCTG TCAGCATGTAGCAATGCAGGACTTTTCGATAGAGGACAAGCTTATTTTAAATCTATCATAGAAGATTATGGCATTGAACCATGCGCAGAGCACTACATGT ATGGTTTGGATTTTTGGGAGATTGGGTCATCTTGA
AA sequence Show only first row Show all	>Potri.001G062566.1 pacid=42788167 polypeptide=Potri.001G062566.1.p locus=Potri.001G062566 ID=Potri.001G062566.1.v4.1 annot-version=v4.1 MHVLVLLPWNQTDSHSLLVKTIYDKNTVVGNALIDMYAKCGSIRDARLVFNMLRECDQVSWSAMIAGYSVHGLCREALKAFELMQETECKPDKVTFVGIL SACSNAGLFDRGQAYFKSIIEDYGIEPCAEHYMYGLDFWEIGSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13230			Tetratricopeptide repeat (TPR)...		Potri.001G062566 [exp]	0	1
AT4G16835			Tetratricopeptide repeat (TPR)...		Potri.003G081700 [exp]	6.16	0.8988
AT1G52380			NUP50 (Nucleoporin 50 kDa) pro...		Potri.001G179100 [exp]	6.92	0.8911
AT5G67640			unknown protein		Potri.007G006000 [exp]	8.12	0.8402
AT1G13040			Pentatricopeptide repeat (PPR-...		Potri.008G185000 [exp]	9.38	0.8615
AT1G21730			P-loop containing nucleoside t...		Potri.002G081300 [exp]	10.67	0.8515
AT2G40360			Transducin/WD40 repeat-like su...		Potri.003G009600 [exp]	12.00	0.8665
AT2G44200			CBF1-interacting co-repressor ...		Potri.016G000501 [exp]	12.00	0.8600
AT5G41580			RING/U-box superfamily protein...		Potri.003G133000 [exp]	13.03	0.8719
AT2G26790			Pentatricopeptide repeat (PPR)...		Potri.010G243002 [exp]	13.22	0.8481
AT5G62370			Tetratricopeptide repeat (TPR)...		Potri.004G200900 [exp]	15.36	0.8721

Compare expression of checked genes

Potri.001G062566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.