Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13230 85 / 6e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G46460 66 / 3e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G37380 63 / 3e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 63 / 3e-13 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G56690 62 / 5e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G16480 61 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G27610 60 / 4e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G20230 60 / 4e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G02010 59 / 6e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 59 / 6e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G164900 [exp] 110 / 7e-30 AT5G13230 950 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G058300 [exp] 64 / 9e-14 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G068600 [exp] 64 / 1e-13 AT1G16480 1183 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G071800 [exp] 64 / 2e-13 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G130900 [exp] 61 / 5e-13 AT1G47580 143 / 1e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G321700 [exp] 61 / 1e-12 AT4G14050 808 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G184800 [exp] 61 / 1e-12 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G018700 [exp] 61 / 2e-12 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G038900 [exp] 61 / 2e-12 AT2G15690 280 / 1e-88 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014956 [exp] 86 / 2e-21 AT5G13230 484 / 1e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038839 [exp] 86 / 5e-21 AT5G13230 715 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032688 [exp] 66 / 2e-14 AT2G15690 375 / 2e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019864 [exp] 66 / 3e-14 AT2G15690 477 / 3e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014049 [exp] 66 / 3e-14 AT2G15690 478 / 2e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013578 [exp] 64 / 2e-13 AT1G16480 1036 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10008570 [exp] 63 / 3e-13 AT2G15690 375 / 9e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019689 [exp] 60 / 4e-13 AT2G22070 246 / 4e-78 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10030581 [exp] 62 / 5e-13 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10019735 [exp] 62 / 7e-13 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0109 [poplar] [flax] CDA PF14432 [poplar] [flax] DYW_deaminase DYW family of nucleic acid deaminases
Representative CDS sequence Show only first row Show all	>Potri.001G062632.1 pacid=42788319 polypeptide=Potri.001G062632.1.p locus=Potri.001G062632 ID=Potri.001G062632.1.v4.1 annot-version=v4.1 ATGATTAAGGGGATGCTGGAGTGGTTGAACGTGAAAGCCAGGAATGAAGGTCATGTTCCTGATTGTAGTTCTGTTTTGCTTGATGTGGACGATGTTGATA AGGAACAGTGGTTGTGGGTCCACAGTGAAAGACTAGCTTTAGCATATGGTCTAATTAGAACTCCATCCATATGCCATGTTCACATTATAAAGAATCTCCG TATATGTGCTGGCAGTCATACTGCAATAAAATAA
AA sequence Show only first row Show all	>Potri.001G062632.1 pacid=42788319 polypeptide=Potri.001G062632.1.p locus=Potri.001G062632 ID=Potri.001G062632.1.v4.1 annot-version=v4.1 MIKGMLEWLNVKARNEGHVPDCSSVLLDVDDVDKEQWLWVHSERLALAYGLIRTPSICHVHIIKNLRICAGSHTAIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13230			Tetratricopeptide repeat (TPR)...		Potri.001G062632 [exp]	0	1
					Potri.004G143001 [exp]	75.48	0.5272
AT5G27930			Protein phosphatase 2C family ...		Potri.013G012200 [exp]	78.30	0.5239
AT5G50011		CPuORF37	conserved peptide upstream ope...		Potri.002G103400 [exp]	106.95	0.4730
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.005G036100 [exp]	131.14	0.4651
AT1G05500		SYT5, NTMCTYPE2...	synaptotagmin 5, ARABIDOPSIS T...		Potri.018G124000 [exp]	150.12	0.4643
AT5G67350			unknown protein		Potri.005G145100 [exp]	184.85	0.4542
AT2G36835			unknown protein		Potri.006G122200 [exp]	186.08	0.4622

Compare expression of checked genes

Potri.001G062632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.