Potri.001G063500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58190 71 / 8e-15 AtRLP9 receptor like protein 9 (.1.2)
AT1G54470 69 / 3e-14 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2)
AT5G49290 68 / 7e-14 ATRLP56 receptor like protein 56 (.1)
AT1G74180 67 / 2e-13 AtRLP14 receptor like protein 14 (.1)
AT1G74190 62 / 9e-12 AtRLP15 receptor like protein 15 (.1)
AT2G25470 58 / 3e-10 AtRLP21 receptor like protein 21 (.1)
AT3G53240 53 / 1e-08 AtRLP45 receptor like protein 45 (.1)
AT3G11080 49 / 3e-07 AtRLP35 receptor like protein 35 (.1)
AT4G13880 48 / 5e-07 AtRLP48 receptor like protein 48 (.1)
AT5G53890 47 / 1e-06 AtPSKR2 phytosylfokine-alpha receptor 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145520 281 / 7e-99 AT1G54470 67 / 1e-13 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2)
Potri.001G065318 219 / 3e-72 AT1G74190 81 / 1e-16 receptor like protein 15 (.1)
Potri.001G063909 219 / 4e-67 AT1G74190 333 / 3e-99 receptor like protein 15 (.1)
Potri.001G064900 214 / 3e-65 AT1G07390 290 / 7e-83 receptor like protein 1 (.1.2.3)
Potri.018G145512 213 / 1e-64 AT2G25470 338 / 5e-101 receptor like protein 21 (.1)
Potri.003G041600 212 / 3e-64 AT1G74170 333 / 2e-98 receptor like protein 13 (.1)
Potri.001G065327 211 / 3e-64 AT1G07390 352 / 3e-105 receptor like protein 1 (.1.2.3)
Potri.003G041700 210 / 3e-64 AT1G58190 247 / 4e-69 receptor like protein 9 (.1.2)
Potri.018G148000 211 / 5e-64 AT1G74190 354 / 1e-106 receptor like protein 15 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030068 78 / 3e-17 AT5G49290 397 / 3e-124 receptor like protein 56 (.1)
Lus10027856 76 / 3e-16 AT1G74190 272 / 1e-77 receptor like protein 15 (.1)
Lus10042381 71 / 1e-14 AT1G74190 289 / 1e-82 receptor like protein 15 (.1)
Lus10016339 55 / 3e-09 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10002757 49 / 6e-08 AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1)
Lus10016338 51 / 7e-08 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Lus10001035 50 / 2e-07 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1)
Lus10039529 50 / 2e-07 AT2G34930 427 / 1e-134 disease resistance family protein / LRR family protein (.1)
Lus10016384 49 / 4e-07 AT2G34930 464 / 5e-148 disease resistance family protein / LRR family protein (.1)
Lus10016340 49 / 5e-07 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Potri.001G063500.2 pacid=42788060 polypeptide=Potri.001G063500.2.p locus=Potri.001G063500 ID=Potri.001G063500.2.v4.1 annot-version=v4.1
ATGAGACTAAAGGCTTTCATATTGTTTCACTTTATTGAGATGTTGATGGTTTTAGTGATGATGGCTTCCTTGCAAGGACGGCTGCCTCTTTGTTGCTTGG
GGGAAGAGAGAATCGCTCTCTTGCAGCTCAAAGATGCTCTTCACTATCCCAATGGCACATCCCTTCCCTCCTGGATAAAAGGCCACGCTCACTGTTGTGA
TTGGGAAAGTATTATCTGCAGCAGCAGTACAGGTCGAGTCACCGCACTCGTTCTTGACAGCACAAGGAATCAGGAACTGGGAGATTGGTACTTAAATGCC
TCATTGTTTCTTCCTTTCCAAGAACTCAACGCTCTTTACTTGTCAGATAATCGTATAGCTGGTTGGGTTAAGAACAAAGGTAGTTATGAACTACTGAGAT
TGAGCAATTTGGAGCACCTTGACTTGAGATATAATCGCTTCGATAACAGTTGTTGCACGTGTGCGGCGTCACGGTGA
AA sequence
>Potri.001G063500.2 pacid=42788060 polypeptide=Potri.001G063500.2.p locus=Potri.001G063500 ID=Potri.001G063500.2.v4.1 annot-version=v4.1
MRLKAFILFHFIEMLMVLVMMASLQGRLPLCCLGEERIALLQLKDALHYPNGTSLPSWIKGHAHCCDWESIICSSSTGRVTALVLDSTRNQELGDWYLNA
SLFLPFQELNALYLSDNRIAGWVKNKGSYELLRLSNLEHLDLRYNRFDNSCCTCAASR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G58190 AtRLP9 receptor like protein 9 (.1.2) Potri.001G063500 0 1
AT2G34930 disease resistance family prot... Potri.010G106900 3.46 0.9008
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Potri.014G078600 5.74 0.9060
AT3G51550 FER FERONIA, Malectin/receptor-lik... Potri.011G165800 6.63 0.8900
AT1G34210 ATSERK2, SERK2 somatic embryogenesis receptor... Potri.007G082300 10.24 0.8951
Potri.019G017304 27.22 0.8893
AT1G64660 ATMGL methionine gamma-lyase (.1) Potri.003G187032 29.08 0.8958
AT1G16670 Protein kinase superfamily pro... Potri.011G112000 29.29 0.8559
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Potri.019G007227 39.49 0.8728
Potri.011G081701 46.05 0.8822
AT4G37290 unknown protein Potri.005G142900 47.83 0.8803

Potri.001G063500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.