Potri.001G065318 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74190 81 / 1e-16 AtRLP15 receptor like protein 15 (.1)
AT1G58190 79 / 3e-16 AtRLP9 receptor like protein 9 (.1.2)
AT3G53240 75 / 6e-15 AtRLP45 receptor like protein 45 (.1)
AT5G49290 74 / 2e-14 ATRLP56 receptor like protein 56 (.1)
AT1G74180 73 / 2e-14 AtRLP14 receptor like protein 14 (.1)
AT1G54470 72 / 4e-14 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2)
AT2G25470 68 / 2e-12 AtRLP21 receptor like protein 21 (.1)
AT3G11080 62 / 1e-10 AtRLP35 receptor like protein 35 (.1)
AT1G07390 56 / 2e-08 AtRLP1 receptor like protein 1 (.1.2.3)
AT3G05660 52 / 2e-07 AtRLP33 receptor like protein 33 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G041700 275 / 1e-86 AT1G58190 247 / 4e-69 receptor like protein 9 (.1.2)
Potri.003G041600 276 / 1e-85 AT1G74170 333 / 2e-98 receptor like protein 13 (.1)
Potri.001G063909 271 / 7e-84 AT1G74190 333 / 3e-99 receptor like protein 15 (.1)
Potri.018G145512 269 / 3e-83 AT2G25470 338 / 5e-101 receptor like protein 21 (.1)
Potri.001G064900 266 / 5e-82 AT1G07390 290 / 7e-83 receptor like protein 1 (.1.2.3)
Potri.001G063300 262 / 1e-80 AT1G07390 330 / 1e-96 receptor like protein 1 (.1.2.3)
Potri.018G148000 259 / 1e-79 AT1G74190 354 / 1e-106 receptor like protein 15 (.1)
Potri.001G065327 257 / 6e-79 AT1G07390 352 / 3e-105 receptor like protein 1 (.1.2.3)
Potri.018G144800 255 / 2e-78 AT1G74170 284 / 1e-81 receptor like protein 13 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027856 85 / 3e-18 AT1G74190 272 / 1e-77 receptor like protein 15 (.1)
Lus10030068 81 / 8e-17 AT5G49290 397 / 3e-124 receptor like protein 56 (.1)
Lus10042381 79 / 5e-16 AT1G74190 289 / 1e-82 receptor like protein 15 (.1)
Lus10016339 62 / 2e-10 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10001035 59 / 2e-09 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1)
Lus10016340 59 / 2e-09 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
Lus10002757 56 / 2e-09 AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1)
Lus10016337 57 / 1e-08 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1)
Lus10016338 57 / 1e-08 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Lus10016341 56 / 2e-08 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
CL0022 PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Potri.001G065318.1 pacid=42792407 polypeptide=Potri.001G065318.1.p locus=Potri.001G065318 ID=Potri.001G065318.1.v4.1 annot-version=v4.1
ATGGGGCTGTTCCTTCAGATGTTGACGGTGTTTGTAACGATGGTTTCCCTGCAAGGATGGCTGCCTCTTGGTTGCTTGGAGGAAGAGAGAATCGCTCTGT
TGCACCTCAAAGATGCTCTTAACTATCCTAATGGCACCTCCCTACCCTCCTGGATAAAAGGTGACGCCCACTGCTGTGATTGGGAAAGTATTATCTGCGA
CAGCAGTACAGGTCGAGTCACCGAGCTCGATCTTGAGGGCGTAAGGGATCGGGAACTGGGAGATTGGTACTTAAATGCCTCCTTGTTTCTTCCTTTCCAA
CAACTCAACGGTCTCTACTTGACAGCTAATCGTATAGCTGGGCTGGTTGAGAAGAAAGGTGGTTATGAACAATCAAGATTGAGCAATTTAGAGTACCTTG
ACTTGGGAATTAATGGTTTCGATAACAGTATTTTATCATATGTGGAGCGGCTTTCATCTCTTAAATCACTATATTTGAATTATAATAGACTGGAGGGGTT
AATAGATTTGAAAGATTCCCTGAGTAGCTTGGAGAGATTGGATTTAAGCGGCAACAATATTAATAAATTGGTAGCCTCAACAGGTGGTTATGAGTTAACT
AAATCGAGCAATTTGGAGCATCTTGACTTGGGATATAATCGCTTTGATAATAGTATTTTATCATTTGTGGAGGGGATTTCATCTCTTAAATCATTATATT
TGGATTATAATAGAGTGGAGGGGTTAATAGATTTGAAAGAATCTTTGAGCGGCTTGGAGTTGTTGGGTTTGAACGGCAACAATATTAACAAATTGATAGC
CTCAAGAGGTCCAAGCAGCTTGAGTACTCTATGGCTAGAAAATATCACAACCTATGGAAGGAAGTAG
AA sequence
>Potri.001G065318.1 pacid=42792407 polypeptide=Potri.001G065318.1.p locus=Potri.001G065318 ID=Potri.001G065318.1.v4.1 annot-version=v4.1
MGLFLQMLTVFVTMVSLQGWLPLGCLEEERIALLHLKDALNYPNGTSLPSWIKGDAHCCDWESIICDSSTGRVTELDLEGVRDRELGDWYLNASLFLPFQ
QLNGLYLTANRIAGLVEKKGGYEQSRLSNLEYLDLGINGFDNSILSYVERLSSLKSLYLNYNRLEGLIDLKDSLSSLERLDLSGNNINKLVASTGGYELT
KSSNLEHLDLGYNRFDNSILSFVEGISSLKSLYLDYNRVEGLIDLKESLSGLELLGLNGNNINKLIASRGPSSLSTLWLENITTYGRK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G74190 AtRLP15 receptor like protein 15 (.1) Potri.001G065318 0 1
AT4G05030 Copper transport protein famil... Potri.001G468500 1.41 0.9345
AT1G07390 AtRLP1 receptor like protein 1 (.1.2.... Potri.001G065309 8.12 0.9217
AT4G16380 Heavy metal transport/detoxifi... Potri.006G020000 9.79 0.9077
AT2G25470 AtRLP21 receptor like protein 21 (.1) Potri.018G144300 10.19 0.9203
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Potri.004G024140 11.22 0.9119
AT1G07390 AtRLP1 receptor like protein 1 (.1.2.... Potri.005G009300 12.64 0.8816
AT2G25470 AtRLP21 receptor like protein 21 (.1) Potri.003G013200 14.73 0.9082
AT1G74190 AtRLP15 receptor like protein 15 (.1) Potri.003G026308 16.91 0.8989
AT1G74170 AtRLP13 receptor like protein 13 (.1) Potri.018G144800 18.43 0.9049
AT1G07390 AtRLP1 receptor like protein 1 (.1.2.... Potri.003G026914 21.90 0.8566

Potri.001G065318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.