Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30130 40 / 7e-06 Protein of unknown function (DUF630 and DUF632) (.1) AT2G19090 38 / 7e-05 Protein of unknown function (DUF630 and DUF632) (.1) AT3G51290 36 / 0.0003 Protein of unknown function (DUF630) ;Protein of unknown function (DUF632) (.1), Protein of unknown function (DUF630) ;Protein of unknown function (DUF632) (.2) AT4G39790 35 / 0.001 Protein of unknown function (DUF630 and DUF632) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G077000 [exp] 44 / 6e-07 AT2G19090 664 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Potri.004G197700 [exp] 37 / 0.0002 AT2G27090 804 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Potri.009G159000 [exp] 35 / 0.0005 AT2G27090 746 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Potri.005G077700 [exp] 35 / 0.0008 AT4G39790 546 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Potri.007G090300 [exp] 35 / 0.0009 AT4G39790 556 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041710 [exp] 38 / 0.0001 AT4G39790 645 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Lus10024007 [exp] 37 / 0.0002 AT1G21740 238 / 1e-66 Protein of unknown function (DUF630 and DUF632) (.1) Lus10024039 [exp] 37 / 0.0002 AT4G39790 645 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1) Lus10015534 [exp] 35 / 0.0007 AT2G19090 480 / 4e-160 Protein of unknown function (DUF630 and DUF632) (.1) Lus10020009 [exp] 35 / 0.0007 AT2G19090 381 / 1e-125 Protein of unknown function (DUF630 and DUF632) (.1) Lus10025077 [exp] 35 / 0.0009 AT4G35240 237 / 3e-66 Protein of unknown function (DUF630 and DUF632) (.1), Protein of unknown function (DUF630 and DUF632) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04782 [poplar] [flax] DUF632 Protein of unknown function (DUF632)
Representative CDS sequence Show only first row Show all	>Potri.001G065345.1 pacid=42792994 polypeptide=Potri.001G065345.1.p locus=Potri.001G065345 ID=Potri.001G065345.1.v4.1 annot-version=v4.1 ATGTTCTCATGTAGTCACCAATCAATATTTGACAGATTATATGCCCGGGAGAAGAAACTCTACCAAGAAGTCAGGCAGCTAGGAGGCGATCCACACAGGG TCCCAATCAGTTCAAAGAGATTTGGAGCAGTGTTGTCAGTTGAATGA
AA sequence Show only first row Show all	>Potri.001G065345.1 pacid=42792994 polypeptide=Potri.001G065345.1.p locus=Potri.001G065345 ID=Potri.001G065345.1.v4.1 annot-version=v4.1 MFSCSHQSIFDRLYAREKKLYQEVRQLGGDPHRVPISSKRFGAVLSVE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30130			Protein of unknown function (D...		Potri.001G065345 [exp]	0	1
AT4G30950		FADC, SFD4, FAD...	STEAROYL DESATURASE DEFICIENCY...		Potri.018G107700 [exp]	7.54	0.9537
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Potri.004G147600 [exp]	12.68	0.9595
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Potri.007G100500 [exp]	13.52	0.9624	Pt-NHX8.1
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.019G004500 [exp]	14.28	0.9649	QLEG.3
AT4G31980			unknown protein		Potri.003G206201 [exp]	20.19	0.9582
AT4G20970	bHLH	bHLH162	basic helix-loop-helix (bHLH) ...		Potri.004G044400 [exp]	27.83	0.9489
AT4G05030			Copper transport protein famil...		Potri.016G002600 [exp]	29.47	0.9571
AT5G63520			unknown protein		Potri.012G100600 [exp]	37.60	0.9562
AT5G36930			Disease resistance protein (TI...		Potri.007G143100 [exp]	39.68	0.9401
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G138201 [exp]	45.49	0.9539

Compare expression of checked genes

Potri.001G065345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.