Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01630 360 / 4e-127 Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G14820 149 / 4e-44 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G75170 94 / 1e-22 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G22180 91 / 2e-21 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT4G08690 91 / 2e-21 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT4G36640 87 / 4e-20 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT5G63060 80 / 1e-17 Sec14p-like phosphatidylinositol transfer family protein (.1) AT4G39180 81 / 4e-17 ATSEC14, SEC14 ARABIDOPSIS THALIANA SECRETION 14, Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT4G34580 80 / 7e-17 SRH1, COW1 SHORT ROOT HAIR 1, CAN OF WORMS1, Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G19650 79 / 2e-16 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G162100 [exp] 429 / 2e-154 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.017G063966 [exp] 338 / 5e-118 AT1G01630 340 / 2e-118 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.015G023000 [exp] 167 / 6e-51 AT1G14820 276 / 5e-94 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.008G135600 [exp] 163 / 2e-49 AT1G14820 323 / 2e-112 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.010G105400 [exp] 157 / 4e-47 AT1G14820 326 / 1e-113 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.002G261000 [exp] 89 / 6e-21 AT1G75170 427 / 3e-152 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.007G025800 [exp] 89 / 2e-20 AT1G75170 408 / 2e-144 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.007G025900 [exp] 88 / 3e-20 AT1G75170 369 / 3e-129 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.004G157600 [exp] 88 / 1e-19 AT2G21540 709 / 0.0 SEC14-like 3 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004684 [exp] 324 / 1e-112 AT1G01630 326 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10040252 [exp] 320 / 7e-111 AT1G01630 319 / 8e-111 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10022428 [exp] 311 / 7e-108 AT1G01630 323 / 1e-112 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10016733 [exp] 307 / 4e-106 AT1G01630 325 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10003699 [exp] 174 / 5e-54 AT1G14820 316 / 1e-109 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10001584 [exp] 172 / 3e-53 AT1G14820 320 / 2e-111 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10034577 [exp] 159 / 2e-48 AT1G14820 257 / 3e-87 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10016312 [exp] 96 / 2e-23 AT1G75170 387 / 2e-136 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10010804 [exp] 95 / 5e-23 AT1G75170 393 / 7e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10025128 [exp] 91 / 1e-21 AT1G75170 380 / 3e-134 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0512 [poplar] [flax] CRAL_TRIO PF13716 [poplar] [flax] CRAL_TRIO_2 Divergent CRAL/TRIO domain
Representative CDS sequence Show only first row Show all	>Potri.001G068000.1 pacid=42790364 polypeptide=Potri.001G068000.1.p locus=Potri.001G068000 ID=Potri.001G068000.1.v4.1 annot-version=v4.1 ATGGAATTCAGTAACATAGAGGAATCAAATGGGATAATAACAGAAGAGGAAGAGAATGGAACTGAAATCAATGAGATTGAACAACGCAAAGTGCGTCTCA TGAGAGCCTTTGTTGAAAGAGAAGATCCCTCTGTCAAGGAAGTAGACGATTTGATGATCCGGAGATTTCTGCGTGCTCGAGAACTAGACATTGAGAAGGC GTCGACCTTATTCCTAAAGTACCTAAGCTGGAGGCGATCGATTATCCCAAATGGCTTCATATCTTCATCAGAGATTCCAAATGAACTTGCTCAAAACAAG TTGTTTATGCAAGGGATTGATAAGCAGAACCGTCCCATAGTTGTGGTTTTCGGTGCCAGACATAAGCCTTACAAAGGAAGTTTAGAGGAGTTCAAGCGTT TTGTTGCCTACACTCTCGATAGAATATGTGCCAGAATGCCAGCTGGACAGGAAAAGTTTGTGTCCATTGCAGATCTTGAAGGGTGGGGATACACCAATAG TGATATTCGTGGATATCTAGCAGCATTATCAATATTGCAGGATTGCTTCCCAGAGAGGTTAGGTAAATTGTTCATAGTTCATGTGCCCTACATATTTATG ACTGCATGGAAGGTTGTCTACCCGTTTATTGACAGCAAAACCAAAAAGAAGATAATCTTTGTCGAGAACAAAAAACTGAGATCCACTCTGCTTGGCGACA TTGATGAGAGCCAGCTCCCAGATGTATATGGAGGCAAGCTGTCATTAGTTCCTATCCAAGACGACTAG
AA sequence Show only first row Show all	>Potri.001G068000.1 pacid=42790364 polypeptide=Potri.001G068000.1.p locus=Potri.001G068000 ID=Potri.001G068000.1.v4.1 annot-version=v4.1 MEFSNIEESNGIITEEEENGTEINEIEQRKVRLMRAFVEREDPSVKEVDDLMIRRFLRARELDIEKASTLFLKYLSWRRSIIPNGFISSSEIPNELAQNK LFMQGIDKQNRPIVVVFGARHKPYKGSLEEFKRFVAYTLDRICARMPAGQEKFVSIADLEGWGYTNSDIRGYLAALSILQDCFPERLGKLFIVHVPYIFM TAWKVVYPFIDSKTKKKIIFVENKKLRSTLLGDIDESQLPDVYGGKLSLVPIQDD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01630			Sec14p-like phosphatidylinosit...		Potri.001G068000 [exp]	0	1
AT5G19290			alpha/beta-Hydrolases superfam...		Potri.008G040000 [exp]	5.65	0.7910
AT1G17200			Uncharacterised protein family...		Potri.001G436400 [exp]	7.93	0.7879
AT2G46300			Late embryogenesis abundant (L...		Potri.002G167300 [exp]	17.60	0.7547
AT3G18570			Oleosin family protein (.1)		Potri.012G059400 [exp]	17.86	0.7558
AT3G48750		CDKA1, CDC2A, C...	cell division control 2 (.1)		Potri.004G133500 [exp]	20.63	0.8007	Pt-CDC2.1,1
AT5G03260		LAC11	laccase 11 (.1)		Potri.009G102700 [exp]	21.07	0.7500
AT1G65720			unknown protein		Potri.017G142100 [exp]	26.00	0.7736
AT2G28410			unknown protein		Potri.009G013800 [exp]	37.82	0.7398
AT1G04630		MEE4	maternal effect embryo arrest ...		Potri.003G173800 [exp]	41.92	0.7882
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Potri.010G215500 [exp]	43.87	0.7785

Compare expression of checked genes

Potri.001G068000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.