Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13410 332 / 5e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G19830 70 / 4e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G60370 69 / 8e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 66 / 7e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 50 / 4e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 48 / 1e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 44 / 1e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G18170 45 / 2e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G64350 42 / 6e-05 FKP12, ATFKBP12, FKBP12 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) AT5G48580 42 / 0.0001 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G045600 [exp] 73 / 3e-15 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G119800 [exp] 70 / 2e-14 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.007G134600 [exp] 61 / 4e-11 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.017G017500 [exp] 61 / 9e-11 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G467100 [exp] 53 / 3e-08 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G048300 [exp] 50 / 4e-07 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 46 / 8e-06 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 44 / 4e-05 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.012G129200 [exp] 44 / 7e-05 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009828 [exp] 331 / 1e-115 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040937 [exp] 325 / 2e-113 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10042897 [exp] 79 / 1e-17 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10028194 [exp] 76 / 5e-16 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10036206 [exp] 70 / 2e-14 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038345 [exp] 66 / 7e-13 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027115 [exp] 56 / 5e-09 AT2G43560 276 / 5e-94 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10008359 [exp] 55 / 8e-09 AT2G43560 273 / 1e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038954 [exp] 49 / 1e-06 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027729 [exp] 48 / 2e-06 AT3G10060 285 / 1e-97 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.001G068300.4 pacid=42787749 polypeptide=Potri.001G068300.4.p locus=Potri.001G068300 ID=Potri.001G068300.4.v4.1 annot-version=v4.1 ATGGCCTCCATTTCAACTCTTGGAATTCCATTCCAATCCCCTGGAAGAGCTTCAACATCCACAAGATGTTGCAGACCGATTGCAACTCTAACTTCTCACC ATCCAGATGTTTGTATTAAAAAATGTGCCGGGGTCATCGAGAGAAGACAAGTTATAATGTTATCTGTTGGGTTACTGGCCGGAGCAGCTCTGCAGCATTC TTCTTCAAATAAAGATGCTGCAGCTATGGCAGCCGAATTCACTGACATGCCAGCTCTCAGGGGGAAGGATTATGGCAAAACAAAAATGCGGTATCCGGAC TACACAGAAACAGAATCAGGTCTTCAGTATAAGGACTTGCGAGCAGGAAATGGTCCCTTGCCTAAGATGGGAGAGACGGTTGTGGTCGATTGGGATGGTT ACACCATAGGATACTATGGTCGCATATTTGAAGCTCGAAACAAGACAAAAGGTGGCTCCTTTGAGGGAGATGACAAGGACTTCTTCAAATTCAGACTAGG ATCCAGAGAGGTTATACCTGCTTTTGAAGAAGCTGTTTCAGGAATGGCCCCGGGTGGCATTAGAAGGATCATTGTGCCCCCAGAACTAGGATATCCTGAG AATGACTACAACAAGAGTGGGCCAAGACCAACAACATTTTCGGGTCAACGAGCCTTGGATTTTGTGTTGAGGAACCAAGGGCTGATAGACAAAACTTTGC TGTTCGATATTGAACTCCTTAAAGTAATCCCAGGCTAA
AA sequence Show only first row Show all	>Potri.001G068300.4 pacid=42787749 polypeptide=Potri.001G068300.4.p locus=Potri.001G068300 ID=Potri.001G068300.4.v4.1 annot-version=v4.1 MASISTLGIPFQSPGRASTSTRCCRPIATLTSHHPDVCIKKCAGVIERRQVIMLSVGLLAGAALQHSSSNKDAAAMAAEFTDMPALRGKDYGKTKMRYPD YTETESGLQYKDLRAGNGPLPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDFFKFRLGSREVIPAFEEAVSGMAPGGIRRIIVPPELGYPE NDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKVIPG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13410			FKBP-like peptidyl-prolyl cis-...		Potri.001G068300 [exp]	0	1
AT3G09210		PTAC13	plastid transcriptionally acti...		Potri.006G094800 [exp]	1.41	0.9897
AT3G26900		ATSKL1	Arabidopsis thaliana shikimate...		Potri.017G062800 [exp]	2.82	0.9847	SK1
AT2G22780		PMDH1	peroxisomal NAD-malate dehydro...		Potri.001G287400 [exp]	3.46	0.9806	MDHG.2
AT1G08070		EMB3102, OTP82	ORGANELLE TRANSCRIPT PROCESSIN...		Potri.018G071800 [exp]	3.46	0.9818
AT5G55740		CRR21	chlororespiratory reduction 21...		Potri.006G155400 [exp]	4.35	0.9737
AT1G11430			plastid developmental protein ...		Potri.011G032900 [exp]	4.58	0.9825
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Potri.004G120300 [exp]	5.29	0.9805
AT3G61870			unknown protein		Potri.014G102400 [exp]	8.06	0.9814
AT2G36145			unknown protein		Potri.006G210000 [exp]	8.48	0.9804
AT3G06950			Pseudouridine synthase family ...		Potri.008G206200 [exp]	8.60	0.9701

Compare expression of checked genes

Potri.001G068300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.