Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G32450 65 / 8e-13 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT3G01210 56 / 1e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G14340 55 / 3e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G16840 52 / 5e-08 BPA1 binding partner of acd11 1 (.1.2.3) AT4G17720 41 / 0.0002 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G53650 40 / 0.0005 CID8 CTC-interacting domain 8 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G055100 [exp] 64 / 2e-12 AT5G32450 389 / 9e-138 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.019G037600 [exp] 62 / 1e-11 AT5G32450 400 / 2e-142 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G081400 [exp] 55 / 4e-09 AT1G14340 229 / 3e-75 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G103600 [exp] 55 / 5e-09 AT1G67950 280 / 6e-94 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) Potri.017G081500 [exp] 54 / 9e-09 AT1G14340 239 / 6e-80 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G058300 [exp] 49 / 5e-07 AT3G23900 447 / 2e-142 RNA recognition motif (RRM)-containing protein (.1), RNA recognition motif (RRM)-containing protein (.2), RNA recognition motif (RRM)-containing protein (.3) Potri.001G319000 [exp] 49 / 7e-07 AT3G23900 386 / 4e-119 RNA recognition motif (RRM)-containing protein (.1), RNA recognition motif (RRM)-containing protein (.2), RNA recognition motif (RRM)-containing protein (.3) Potri.001G138400 [exp] 47 / 3e-06 AT4G17720 365 / 2e-127 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G022000 [exp] 43 / 5e-05 AT1G32790 428 / 4e-150 CTC-interacting domain 11 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025743 [exp] 60 / 1e-10 AT4G17720 295 / 4e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10007254 [exp] 58 / 6e-10 AT1G14340 244 / 2e-75 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10010660 [exp] 56 / 2e-09 AT5G32450 352 / 3e-122 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013651 [exp] 54 / 1e-08 AT5G32450 343 / 5e-117 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10021813 [exp] 54 / 2e-08 AT2G01690 1112 / 0.0 ARM repeat superfamily protein (.1.2) Lus10034580 [exp] 52 / 3e-08 AT1G67950 177 / 4e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) Lus10030491 [exp] 47 / 1e-06 AT1G14340 300 / 1e-103 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10012843 [exp] 47 / 3e-06 AT1G14340 301 / 5e-104 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043159 [exp] 44 / 3e-05 AT3G23900 635 / 0.0 RNA recognition motif (RRM)-containing protein (.1), RNA recognition motif (RRM)-containing protein (.2), RNA recognition motif (RRM)-containing protein (.3) Lus10032590 [exp] 40 / 0.0007 AT3G23900 647 / 0.0 RNA recognition motif (RRM)-containing protein (.1), RNA recognition motif (RRM)-containing protein (.2), RNA recognition motif (RRM)-containing protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Potri.001G070200.2 pacid=42792950 polypeptide=Potri.001G070200.2.p locus=Potri.001G070200 ID=Potri.001G070200.2.v4.1 annot-version=v4.1 ATGGCTCAGTCAGATTTAACTATTCAAGTTCTCAACCTGTCCCCCAGTGTGACTCGCGCAGAGTTGAATACCTTCTTCTCTTATTGTGGAACTGTTGAGA AGATTGAGCTTCAGAACAGAGACAAAGACCAAATGCAGTCAGCTCTAGTGACTTTCACACAGCCATATGCTTTTCAGACTGCTCTTCTCCTGAGTGATGC TCTCCTTGGTGGGCAGCCAATTCGGATATTGTCTGCGCATGATATAGAGATCCCTATCACCGGTCCAGATATAAGAAAGAACCATGGATCGTCCAGATTT GTTCCGGCAGTGCAAGTTGCGATGCAGACAGTGGCTTTGAAAAGCGTTGAAATGTTGAGCAAGGCCAGAGAACTAGAGGAGAATTACAAGCTGTCAGAGA AAGGAAAGACACTAGCGCTCCAAACAAGAGCAGCAGTCTATGATGCTGAGCAGGCAGCAGAAAACTATGTTTCGGCTGGTGCTGGGTGGTTGTCCGGTGC ACTTGATAAGACGTCCAAACGTGTCTTGTCACTGGGAACTGTGAAGAGGAATAACTCCTAA
AA sequence Show only first row Show all	>Potri.001G070200.2 pacid=42792950 polypeptide=Potri.001G070200.2.p locus=Potri.001G070200 ID=Potri.001G070200.2.v4.1 annot-version=v4.1 MAQSDLTIQVLNLSPSVTRAELNTFFSYCGTVEKIELQNRDKDQMQSALVTFTQPYAFQTALLLSDALLGGQPIRILSAHDIEIPITGPDIRKNHGSSRF VPAVQVAMQTVALKSVEMLSKARELEENYKLSEKGKTLALQTRAAVYDAEQAAENYVSAGAGWLSGALDKTSKRVLSLGTVKRNNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Potri.001G070200 [exp]	0	1
AT5G45320			unknown protein		Potri.003G046000 [exp]	2.23	0.9295
AT3G18670			Ankyrin repeat family protein ...		Potri.005G057900 [exp]	9.59	0.9126
AT5G62200			Embryo-specific protein 3, (AT...		Potri.010G214400 [exp]	13.41	0.9095
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340200 [exp]	15.49	0.9062
AT1G62045			unknown protein		Potri.011G004400 [exp]	15.58	0.8325
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340400 [exp]	16.15	0.9098
					Potri.018G104500 [exp]	21.90	0.8903
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Potri.017G053000 [exp]	24.00	0.8889
AT5G51160			Ankyrin repeat family protein ...		Potri.014G051100 [exp]	24.12	0.9013
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Potri.013G120000 [exp]	27.12	0.8939

Compare expression of checked genes

Potri.001G070200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.