Potri.001G070800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G44960 278 / 2e-94 SNARE associated Golgi protein family (.1)
AT1G03260 47 / 6e-06 SNARE associated Golgi protein family (.1)
AT1G12450 40 / 0.001 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G159901 173 / 2e-55 AT1G44960 152 / 2e-47 SNARE associated Golgi protein family (.1)
Potri.001G078700 40 / 0.0009 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
Potri.003G117400 40 / 0.001 AT1G12450 343 / 1e-118 SNARE associated Golgi protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028709 279 / 7e-95 AT1G44960 305 / 5e-105 SNARE associated Golgi protein family (.1)
Lus10006050 244 / 1e-81 AT1G44960 273 / 2e-93 SNARE associated Golgi protein family (.1)
Lus10017913 41 / 0.0006 AT4G09580 442 / 2e-158 SNARE associated Golgi protein family (.1)
Lus10014818 40 / 0.0006 AT1G71940 374 / 2e-132 SNARE associated Golgi protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.001G070800.1 pacid=42787700 polypeptide=Potri.001G070800.1.p locus=Potri.001G070800 ID=Potri.001G070800.1.v4.1 annot-version=v4.1
ATGGGTAAATGGTTGAAAGTAGCTGCTGTGATTGGGCTGATAGCTATAGCAAGAGAACTGAGCAAACAATTCGGATGGGACAAAGACGCAGCTCTTGAGC
TACTTGGTGAATGGTCAGATCGATTAGGGGTTTGGGCAATGCCTGTTTACGTTGGGATTCACACAATCTCTCTCGCTCTCTGCTTGCCTTGCGCTGTTTT
TTTCGAGGCTGGTGCTTCTTTGCTGTTTGGGTTCTTGCCTGCTGTTCTCTGTGTCTTCTTTGCCAAGGTCTTAGGTGCCTCTCTTTCCTTCTGGATCGGC
AGGCTAGTTTTCAGGAGTTCCAGTTCAGCAATGGAGTGGGTGCAGAGTAACAAATATTTCCATCTGCTTTCCAGAGGAGTTGAAAAGGATGGATGGAAAT
TTGTTCTTCTTGCACGCTTCTCACCCATGCCCTCCTATCTTATAAACTATGCTCTAGCTGCTACAAAAGTTGGGTTCATGGTTGATTTTCTGCTTCCTAC
AGTTGTTGGCTGCCTCCCAATGATCCTACAGAACACATCCATTGGTAGCCTTGCTGGTGCTGCTGTTGCTTCAGCATCTGGCTCTAAAAAATCTCAGATT
TGGTCTTACCTATTTCCTTTACTTGGGATTGTATCAAGTATCCTTATTTCCTTGAGGATCAAAAAGTACTCTACTGATATAACATTGGCTGAATCCTCTA
CCAATGATTCTCCTCATACCTCTAGTAAAAATGGAAGCAAGGGCCTAAAGAAAAACGTCAATAAAGGACTCCTATAG
AA sequence
>Potri.001G070800.1 pacid=42787700 polypeptide=Potri.001G070800.1.p locus=Potri.001G070800 ID=Potri.001G070800.1.v4.1 annot-version=v4.1
MGKWLKVAAVIGLIAIARELSKQFGWDKDAALELLGEWSDRLGVWAMPVYVGIHTISLALCLPCAVFFEAGASLLFGFLPAVLCVFFAKVLGASLSFWIG
RLVFRSSSSAMEWVQSNKYFHLLSRGVEKDGWKFVLLARFSPMPSYLINYALAATKVGFMVDFLLPTVVGCLPMILQNTSIGSLAGAAVASASGSKKSQI
WSYLFPLLGIVSSILISLRIKKYSTDITLAESSTNDSPHTSSKNGSKGLKKNVNKGLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G44960 SNARE associated Golgi protein... Potri.001G070800 0 1
AT2G28060 5'-AMP-activated protein kinas... Potri.009G008700 8.94 0.7597
AT1G11780 oxidoreductase, 2OG-Fe(II) oxy... Potri.003G171900 9.79 0.7655
AT2G34250 SecY protein transport family ... Potri.011G107900 10.14 0.8014
AT5G14250 CSN3, FUS11, CO... FUSCA 11, COP9 SIGNALOSOME SUB... Potri.001G334200 12.24 0.7719
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Potri.019G057300 14.76 0.7960 Pt-MSD1.1
AT4G38510 ATPase, V1 complex, subunit B ... Potri.004G177500 32.61 0.7600
AT3G62220 Protein kinase superfamily pro... Potri.014G114200 33.16 0.7672
AT5G59560 SRR1 SENSITIVITY TO RED LIGHT REDUC... Potri.001G026700 45.95 0.6834
AT5G47420 Tryptophan RNA-binding attenua... Potri.003G078900 51.39 0.7067
AT1G12390 Cornichon family protein (.1) Potri.001G116100 69.08 0.7345

Potri.001G070800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.