EXGT.1 (Potri.001G071000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol EXGT.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13870 504 / 0 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 491 / 2e-177 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT5G65730 313 / 3e-107 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT3G23730 310 / 9e-106 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 309 / 2e-105 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G03210 301 / 2e-102 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT4G37800 298 / 3e-101 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G57550 296 / 1e-100 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57560 292 / 5e-99 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT1G11545 288 / 5e-97 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G159700 578 / 0 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 522 / 0 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.007G008500 322 / 1e-110 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.002G060500 318 / 4e-109 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 315 / 5e-108 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 311 / 3e-106 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 310 / 4e-106 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 309 / 1e-105 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 307 / 1e-104 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003022 530 / 0 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10011052 524 / 0 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10040121 524 / 0 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 520 / 0 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039715 321 / 5e-110 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10018503 319 / 2e-109 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10031586 310 / 9e-106 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10011597 308 / 4e-105 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10039643 307 / 9e-105 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10010938 302 / 7e-103 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.001G071000.2 pacid=42792901 polypeptide=Potri.001G071000.2.p locus=Potri.001G071000 ID=Potri.001G071000.2.v4.1 annot-version=v4.1
ATGTGCAGAGATATGGCTGCTTCTCTATGGACTTTGTTTCTTGGCATGCTGTTTATGGTATCTGGGACAATGGGAGCTCCCCCAAGGAAGCCAGTGGATG
TGCCTTTTGGAAGGAACTATGTTCCTACATGGGCTTTTGACCACATTAAGTACTTCAATGGAGGCTCAGAGATACAGCTCCAGTTGGATAATTACACGGG
TACTGGTTTCCAATCAAAAGGGTCATACTTATTTGGCCATTTCAGTATGCAAATGAAGTTGGTTCCTGGTGATTCAGCTGGAACAGTTACTGCTTTCTAT
CTATCTTCACAAAACTCAGAGCATGATGAGATAGACTTTGAGTTCTTAGGAAACAGGACTGGCCAGCCTTACATTTTGCAGACAAATGTTTTCACAGGAG
GCAAGGGAGACAGAGAACAGAGGATTTACCTCTGGTTTGACCCAACCATAAGATACCACTCTTACTCCGTCCTATGGAATTCGTACCTGGTAGTGTTCTT
CGTGGATGATGTGCCAATCAGAGTGTTCAAGAACTGCAAAGACTTGGGAGTGAAATTTCCTTTCAACCAGCCAATGAAGATATACTCAAGCCTATGGAAC
GCCGATGATTGGGCTACCAGGGGTGGACTTGAGAAGACAGACTGGTCCAAGGCACCCTTTATAGCTTCCTACAAGAGCTTCCACATAGATGGGTGTGAGG
CCTCCGTGGAAGCGAAATTCTGTGCCACACAGGGTACCAGATGGTGGGACCAGAAGGAGTTCCAGGATCTTGATGCCTTGCAATACAGGAGGCTCAGATG
GGTACGCCAGAAATACACCATCTACAACTACTGCACTGATAGATCAAGATACCCTTCACTGCCACCAGAATGCAAGAGAGACAGAGACATATAA
AA sequence
>Potri.001G071000.2 pacid=42792901 polypeptide=Potri.001G071000.2.p locus=Potri.001G071000 ID=Potri.001G071000.2.v4.1 annot-version=v4.1
MCRDMAASLWTLFLGMLFMVSGTMGAPPRKPVDVPFGRNYVPTWAFDHIKYFNGGSEIQLQLDNYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAFY
LSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTIRYHSYSVLWNSYLVVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWN
ADDWATRGGLEKTDWSKAPFIASYKSFHIDGCEASVEAKFCATQGTRWWDQKEFQDLDALQYRRLRWVRQKYTIYNYCTDRSRYPSLPPECKRDRDI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Potri.001G071000 0 1 EXGT.1
AT5G55730 FLA1 FASCICLIN-like arabinogalactan... Potri.001G367900 5.47 0.7683
AT5G23370 GRAM domain-containing protein... Potri.005G088400 5.65 0.8067
AT5G23370 GRAM domain-containing protein... Potri.005G088300 6.92 0.8093
AT4G25240 SKS1 SKU5 similar 1 (.1) Potri.015G127200 7.34 0.7797 SKS1.3
Potri.019G001604 12.68 0.7773
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.006G071200 20.78 0.7573 Pt-EXT.6
Potri.015G025701 22.49 0.7474
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Potri.003G193400 23.10 0.8065
AT5G35670 IQD33 IQ-domain 33 (.1) Potri.014G161000 24.81 0.7719
AT4G00231 MEE50 maternal effect embryo arrest ... Potri.008G158901 26.53 0.8029

Potri.001G071000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.