RPL21.2 (Potri.001G071100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL21.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 307 / 5e-109 Translation protein SH3-like family protein (.1)
AT1G09590 307 / 5e-109 Translation protein SH3-like family protein (.1)
AT1G57860 304 / 1e-107 Translation protein SH3-like family protein (.1)
AT1G57660 304 / 1e-107 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G159500 325 / 3e-116 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.006G195400 308 / 4e-109 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 305 / 7e-108 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016241 294 / 1e-103 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10029302 291 / 2e-102 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10030607 291 / 2e-102 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 290 / 3e-102 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10021079 282 / 5e-99 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 282 / 5e-99 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Potri.001G071100.1 pacid=42789653 polypeptide=Potri.001G071100.1.p locus=Potri.001G071100 ID=Potri.001G071100.1.v4.1 annot-version=v4.1
ATGCCGGCTGGACACGGTGTGCGATCAAGGACCAGAGATCTCTTCGCTCGTCCCTTCAGGAAGAAGGGTTACATCCCCCTCTCCACTTATCTCAGAACAT
ACAAGGTAGGCGACTATGTCGACGTCAAGGTAAACGGCGCCGTTCACAAAGGCATGCCCCACAAGTTCTACCATGGCCGCACCGGTCGCGTCTGGAATGT
CACCAAGCGCGCTATTGGTGTCGTCATCAACAAGCAGGTTGGGAATAGGATTATTGGGAAGAAAATTCATGTTAGGGTGGAGCATGTGCAGCCGTCGAGG
TGCAGGGAGGAGTTTAAGTTGAGGAAGAAGAAGAATGATGAGTTGAAGGCTGAGGCCAAAGCTTGTGGTGAAAAGATTAGCACTAAGAGGCAGCCTCAAG
GACCTAAGCCTGGATTTATGTTGGAGGGTGCTACTCTTGAAACTGTCACTCCCATTCCTTATGATGTGGTCAATGATCTCAAGGGTGGTTATTGA
AA sequence
>Potri.001G071100.1 pacid=42789653 polypeptide=Potri.001G071100.1.p locus=Potri.001G071100 ID=Potri.001G071100.1.v4.1 annot-version=v4.1
MPAGHGVRSRTRDLFARPFRKKGYIPLSTYLRTYKVGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVVINKQVGNRIIGKKIHVRVEHVQPSR
CREEFKLRKKKNDELKAEAKACGEKISTKRQPQGPKPGFMLEGATLETVTPIPYDVVNDLKGGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G09690 Translation protein SH3-like f... Potri.001G071100 0 1 RPL21.2
AT3G10950 Zinc-binding ribosomal protein... Potri.014G052400 5.00 0.9138
AT3G11500 Small nuclear ribonucleoprotei... Potri.016G078100 5.19 0.8855
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106532 5.29 0.9200
AT3G16080 Zinc-binding ribosomal protein... Potri.001G183200 9.48 0.8964 Pt-RPL37.3
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106466 10.67 0.9230
AT5G48760 Ribosomal protein L13 family p... Potri.017G054600 16.43 0.9132 RPL13.2
AT4G16720 Ribosomal protein L23/L15e fam... Potri.002G141500 25.29 0.9045 Pt-RPL15.6
AT2G19740 Ribosomal protein L31e family ... Potri.018G070100 26.73 0.8974
AT1G73230 Nascent polypeptide-associated... Potri.017G141100 27.05 0.8996
AT4G15000 Ribosomal L27e protein family ... Potri.016G019000 28.00 0.8973 RPL27.1

Potri.001G071100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.