Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20090 64 / 2e-11 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G01400 57 / 3e-09 unknown protein AT5G24830 52 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G74580 51 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G18020 50 / 7e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G64320 49 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G77360 48 / 3e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 48 / 4e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G65820 47 / 5e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64580 47 / 7e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G181900 [exp] 57 / 2e-09 AT1G77360 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G015900 [exp] 57 / 3e-09 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G234500 [exp] 55 / 2e-08 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G257300 [exp] 54 / 4e-08 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G105900 [exp] 53 / 9e-08 AT4G01400 576 / 0.0 unknown protein Potri.005G050500 [exp] 49 / 1e-06 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.018G004400 [exp] 49 / 1e-06 AT5G24830 500 / 2e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G038300 [exp] 49 / 2e-06 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.016G025600 [exp] 49 / 2e-06 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038398 [exp] 251 / 5e-84 AT4G20090 52 / 2e-07 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001223 [exp] 249 / 2e-83 AT4G20090 53 / 6e-08 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038377 [exp] 64 / 3e-11 AT4G20090 841 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036238 [exp] 63 / 5e-11 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022861 [exp] 57 / 3e-09 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 57 / 5e-09 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035735 [exp] 56 / 9e-09 AT4G11690 526 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10026558 [exp] 51 / 4e-07 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015112 [exp] 50 / 5e-07 AT1G09900 327 / 6e-105 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10013841 [exp] 50 / 6e-07 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.001G075700.2 pacid=42791190 polypeptide=Potri.001G075700.2.p locus=Potri.001G075700 ID=Potri.001G075700.2.v4.1 annot-version=v4.1 ATGAAAATGAAATCAATGGAAGCCAAGCCCCTCCTATTCCTCTTCCTCTCCAATCCATCAAAATCCATTACCATCTCTCCTTTCTCGCACCAGTTGTTTG CATTGTTTTCTTCTTCAATTGATATACCAAAACTCTCCACCAATTCGGAAGTAGTAACAACATTGACACAAGAAGAAGTAACCAAAATCAACCTTCTAAT CCCACGTTTATGTCTATTAAACCACTTAACCACCGCAATCCAATTAATCACAACCTCTCTCCTCGCTAACCCACCTCCAAAGTCCCTTTCTTTTTCCATT CTCACTCACTCTCTCACTTCCCAACCAGACATGACCAAACCCATGTCACTTCTCACCATTCTTAGGCACACCCCACAAGCACATTCACATCTTTCACCTA TGAACACCATGCTTATCACTTCATATATAAAAAAGAAGAGACCCAAAGAGGCCTTGAAAGTGTACAATTGGATGCTTAGGCCTGGCTCTCCATGTAAAGT TGAAAAGATTGTATTTTGTGTTTTGGTTAATGGGTTGTGTGAGATTGGTTGGGTTCTTGAGGGTTTGAAGGTTTTGAAAGACATGGTCAGTGTGGGGTTT TTGCCTATTGGTGGGTTAAAGGAAAGGGTCTATAGGAGTTTGTTGAGCGAGGCTAGGGTGAAGGAGGCAGTGGAGTTAGATAAGGCTTTATGTGATTGTT TTGAGGATGTTAGTGGTGAGGGTGGTAAGAAAGTTATTGACTTGTTGGATTCTTTAATTAGGAACTGGTCTGAGTAA
AA sequence Show only first row Show all	>Potri.001G075700.2 pacid=42791190 polypeptide=Potri.001G075700.2.p locus=Potri.001G075700 ID=Potri.001G075700.2.v4.1 annot-version=v4.1 MKMKSMEAKPLLFLFLSNPSKSITISPFSHQLFALFSSSIDIPKLSTNSEVVTTLTQEEVTKINLLIPRLCLLNHLTTAIQLITTSLLANPPPKSLSFSI LTHSLTSQPDMTKPMSLLTILRHTPQAHSHLSPMNTMLITSYIKKKRPKEALKVYNWMLRPGSPCKVEKIVFCVLVNGLCEIGWVLEGLKVLKDMVSVGF LPIGGLKERVYRSLLSEARVKEAVELDKALCDCFEDVSGEGGKKVIDLLDSLIRNWSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G20090		EMB1025	embryo defective 1025, Pentatr...		Potri.001G075700 [exp]	0	1
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.017G106500 [exp]	2.82	0.8117
					Potri.003G089201 [exp]	3.00	0.8413
AT5G54310		NEV, AGD5	NEVERSHED, ARF-GAP domain 5 (....		Potri.001G406300 [exp]	7.34	0.7491
AT1G05170			Galactosyltransferase family p...		Potri.004G013900 [exp]	7.74	0.7611
AT3G26370			O-fucosyltransferase family pr...		Potri.010G048500 [exp]	9.21	0.7557
AT5G60580			RING/U-box superfamily protein...		Potri.016G022900 [exp]	9.38	0.7637
AT3G44850			Protein kinase superfamily pro...		Potri.009G151500 [exp]	9.79	0.7602
AT3G63290			2-oxoglutarate (2OG) and Fe(II...		Potri.002G049300 [exp]	19.74	0.7589
AT3G59360		UTR6, ATUTR6	UDP-galactose transporter 6 (....		Potri.008G077300 [exp]	21.90	0.7474
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.019G053300 [exp]	24.18	0.7759

Compare expression of checked genes

Potri.001G075700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.