Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61580 94 / 2e-24 PFK4 phosphofructokinase 4 (.1.2) AT4G26270 87 / 7e-22 PFK3 phosphofructokinase 3 (.1) AT4G32840 84 / 8e-21 PFK6 phosphofructokinase 6 (.1) AT5G56630 83 / 2e-20 PFK7 phosphofructokinase 7 (.1) AT4G29220 76 / 5e-18 PFK1 phosphofructokinase 1 (.1) AT5G47810 59 / 9e-12 PFK2 phosphofructokinase 2 (.1) AT2G22480 42 / 5e-06 PFK5 phosphofructokinase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G151100 [exp] 106 / 8e-29 AT5G61580 797 / 0.0 phosphofructokinase 4 (.1.2) Potri.006G235132 [exp] 87 / 7e-23 AT4G26270 399 / 3e-139 phosphofructokinase 3 (.1) Potri.006G152600 [exp] 89 / 2e-22 AT4G26270 827 / 0.0 phosphofructokinase 3 (.1) Potri.018G069200 [exp] 84 / 9e-21 AT4G26270 808 / 0.0 phosphofructokinase 3 (.1) Potri.016G002700 [exp] 64 / 8e-14 AT5G47810 643 / 0.0 phosphofructokinase 2 (.1) Potri.007G010300 [exp] 40 / 2e-05 AT2G22480 816 / 0.0 phosphofructokinase 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006032 [exp] 93 / 6e-24 AT4G26270 742 / 0.0 phosphofructokinase 3 (.1) Lus10043044 [exp] 92 / 1e-23 AT4G26270 840 / 0.0 phosphofructokinase 3 (.1) Lus10011143 [exp] 91 / 4e-23 AT4G26270 837 / 0.0 phosphofructokinase 3 (.1) Lus10005488 [exp] 87 / 8e-22 AT4G32840 765 / 0.0 phosphofructokinase 6 (.1) Lus10035001 [exp] 87 / 1e-21 AT4G26270 812 / 0.0 phosphofructokinase 3 (.1) Lus10008812 [exp] 63 / 3e-13 AT5G47810 697 / 0.0 phosphofructokinase 2 (.1) Lus10002648 [exp] 44 / 1e-06 AT2G22480 868 / 0.0 phosphofructokinase 5 (.1) Lus10012738 [exp] 44 / 1e-06 AT2G22480 869 / 0.0 phosphofructokinase 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G079450.1 pacid=42790414 polypeptide=Potri.001G079450.1.p locus=Potri.001G079450 ID=Potri.001G079450.1.v4.1 annot-version=v4.1 ATGGGAGGTTATAGGGGTTCTTATCCGAGAAACACCATAAATTTCATGCCCAAAGTTGTGAATGACATACATAAGCGCGGTGGCACATTTCTTTGCACTT CACGGGGAGGTCATGATACTAACAAGATAGTTGATATTATTCAGGACAAGAGAATAAATCAGGTGCATACACATTTTTCTTTCATAAATTTCCAAATATG GTACACAACCTGA
AA sequence Show only first row Show all	>Potri.001G079450.1 pacid=42790414 polypeptide=Potri.001G079450.1.p locus=Potri.001G079450 ID=Potri.001G079450.1.v4.1 annot-version=v4.1 MGGYRGSYPRNTINFMPKVVNDIHKRGGTFLCTSRGGHDTNKIVDIIQDKRINQVHTHFSFINFQIWYTT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G61580		PFK4	phosphofructokinase 4 (.1.2)		Potri.001G079450 [exp]	0	1
AT1G31870			unknown protein		Potri.001G147100 [exp]	1.00	0.8694
AT4G32440			Plant Tudor-like RNA-binding p...		Potri.001G173900 [exp]	4.00	0.8284
AT1G31360		MED34, ATRECQ2,...	ARABIDOPSIS THALIANA RECQ 2, ...		Potri.003G104300 [exp]	4.47	0.8221
AT1G03160		FZL	FZO-like (.1.2)		Potri.002G053332 [exp]	5.47	0.8206
AT3G53090		UPL7	ubiquitin-protein ligase 7 (.1...		Potri.016G096500 [exp]	6.92	0.8157
AT3G45890		RUS1	ROOT UVB SENSITIVE 1, Protein ...		Potri.003G033450 [exp]	9.48	0.7899
AT2G32970			unknown protein		Potri.002G224900 [exp]	10.19	0.7752
					Potri.019G120050 [exp]	18.76	0.7862
AT5G17020		HIT2, ATXPO1, A...	HEAT-INTOLERANT 2, ARABIDOPSIS...		Potri.013G088600 [exp]	26.32	0.7676	XPO1.2
AT1G15780			unknown protein		Potri.003G014000 [exp]	34.64	0.7547

Compare expression of checked genes

Potri.001G079450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.