Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25140 108 / 9e-31 OLE1, OLEO1 oleosin 1 (.1) AT2G25890 90 / 8e-24 Oleosin family protein (.1) AT5G51210 85 / 6e-22 OLEO3 oleosin3 (.1) AT3G01570 64 / 2e-13 Oleosin family protein (.1) AT5G40420 62 / 2e-12 OLE2, PA23, OLEO2 oleosin 2 (.1) AT3G27660 59 / 2e-11 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1) AT3G18570 53 / 2e-09 Oleosin family protein (.1) AT5G07550 52 / 2e-09 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3) AT1G48990 47 / 4e-07 Oleosin family protein (.1) AT5G07560 47 / 4e-07 ATGRP20, GRP20 glycine-rich protein 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G150600 [exp] 147 / 1e-46 AT4G25140 124 / 3e-37 oleosin 1 (.1) Potri.006G234900 [exp] 83 / 4e-21 AT2G25890 113 / 1e-32 Oleosin family protein (.1) Potri.018G057800 [exp] 75 / 7e-18 AT2G25890 91 / 5e-24 Oleosin family protein (.1) Potri.012G059400 [exp] 62 / 1e-12 AT3G18570 113 / 4e-32 Oleosin family protein (.1) Potri.012G083400 [exp] 53 / 2e-09 AT5G40420 97 / 2e-25 oleosin 2 (.1) Potri.001G345800 [exp] 52 / 5e-09 AT3G01570 140 / 6e-43 Oleosin family protein (.1) Potri.015G081901 [exp] 51 / 1e-08 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.T125308 [exp] 51 / 1e-08 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.017G071800 [exp] 49 / 6e-08 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031387 [exp] 116 / 3e-34 AT4G25140 164 / 1e-52 oleosin 1 (.1) Lus10027161 [exp] 114 / 4e-33 AT4G25140 154 / 3e-48 oleosin 1 (.1) Lus10039683 [exp] 112 / 3e-32 AT4G25140 159 / 2e-50 oleosin 1 (.1) Lus10028822 [exp] 111 / 3e-32 AT4G25140 146 / 3e-46 oleosin 1 (.1) Lus10017460 [exp] 108 / 5e-31 AT4G25140 136 / 9e-42 oleosin 1 (.1) Lus10010943 [exp] 115 / 7e-31 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10022141 [exp] 76 / 4e-17 AT4G25140 106 / 3e-28 oleosin 1 (.1) Lus10042957 [exp] 63 / 4e-13 AT3G18570 139 / 2e-42 Oleosin family protein (.1) Lus10032461 [exp] 62 / 2e-12 AT3G18570 142 / 1e-43 Oleosin family protein (.1) Lus10017992 [exp] 58 / 4e-11 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01277 [poplar] [flax] Oleosin Oleosin
Representative CDS sequence Show only first row Show all	>Potri.001G080000.1 pacid=42791680 polypeptide=Potri.001G080000.1.p locus=Potri.001G080000 ID=Potri.001G080000.1.v4.1 annot-version=v4.1 ATGGCTGAGCTTCAACAATCACAGCAACCAGGGAAACAACCGAGGTCCCAGCAAATAGTCAAGGCAACTACTGCTGTCACTGCTGGTGGATCTCTCTTAG TTCTCTCCGGTTTGACCCTTGCTGCCACGGTCATTCTGTTGACCATAGCCACTCCATTGCTGGTCATATTCAGTCCAGTTATTGTTCCTGCTGTGATGGC AGTTTCTCTCTTGCTTATGGGGTTCTTGGCCTCTGGTGGCTTTGGTGTGGCAGGAATTACTGCCATGTCATGGATCTATGGGTATGTTACTGGGAGGCAT CCTCCAGGGTCAGACCAGCTGGAACAGGCACGCATAAAGTTGGCTGTTAAGGCAAGGGAAATGAAAGACAGGGCTGAGCAGTTTGGGCATCAAGTTATTT CTTGA
AA sequence Show only first row Show all	>Potri.001G080000.1 pacid=42791680 polypeptide=Potri.001G080000.1.p locus=Potri.001G080000 ID=Potri.001G080000.1.v4.1 annot-version=v4.1 MAELQQSQQPGKQPRSQQIVKATTAVTAGGSLLVLSGLTLAATVILLTIATPLLVIFSPVIVPAVMAVSLLLMGFLASGGFGVAGITAMSWIYGYVTGRH PPGSDQLEQARIKLAVKAREMKDRAEQFGHQVIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.001G080000 [exp]	0	1
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Potri.017G018801 [exp]	2.00	0.9705
AT5G12260			unknown protein		Potri.012G121826 [exp]	4.00	0.9427
AT3G54490		RPB5E	"RNA polymerase II fifth large...		Potri.003G200450 [exp]	6.70	0.9103
AT5G17620			unknown protein		Potri.013G072300 [exp]	6.92	0.9381
AT1G57790			F-box family protein (.1)		Potri.012G106800 [exp]	9.53	0.9275
AT1G54850			HSP20-like chaperones superfam...		Potri.013G024900 [exp]	10.24	0.9052
AT5G04000			unknown protein		Potri.016G044001 [exp]	11.31	0.9046
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Potri.003G130000 [exp]	12.16	0.8740
AT3G22880		ARLIM15, ATDMC1	ARABIDOPSIS THALIANA DISRUPTIO...		Potri.008G158500 [exp]	12.32	0.8971
					Potri.008G089401 [exp]	14.83	0.9098

Compare expression of checked genes

Potri.001G080000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.