Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19610 105 / 3e-27 nucleotide binding;nucleic acid binding;RNA binding (.1) AT5G08695 88 / 4e-21 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G05720 60 / 4e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G149600 [exp] 197 / 7e-60 AT4G19610 646 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040636 [exp] 162 / 4e-47 AT4G19610 700 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1) Lus10018277 [exp] 138 / 2e-38 AT4G19610 770 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G081000.1 pacid=42787873 polypeptide=Potri.001G081000.1.p locus=Potri.001G081000 ID=Potri.001G081000.1.v4.1 annot-version=v4.1 ATGGGTTTTGGCTTTATAGAGTTAATTGATTCTGTGGAAACAGCTACAAATATCTGCAGAGATCTACAAGGAACTGTTTTGGATGGCCATGCTCATATTT TGCAACTTTGCCATGCCCAGAAGGATGAACATGCAGTGAAAAAGGCTGGGAAGGATAAGAGTTCTACAAAACTACTTGTGAGAAATGTAGCTTTTGAGGC AACAGAGAAAGATCTCACACAACTATTTAGCCCATTTGGCCAGGTTCTGGAGAGAGCGAAGGAAGGTGAGAGCTTGGAAGAATTACGGGCTCGCAGCCTC GCACGGCTGGCAGCACAATTTACCGAGGAGCAAAATGGTTTCCAGAATCCAGCCAAGTTATCCAAAAAGAGGAAGGACGTCACTAACTTGGACCAAGAAA GCATGAAGTTCTGGAGAATAACAGACTAG
AA sequence Show only first row Show all	>Potri.001G081000.1 pacid=42787873 polypeptide=Potri.001G081000.1.p locus=Potri.001G081000 ID=Potri.001G081000.1.v4.1 annot-version=v4.1 MGFGFIELIDSVETATNICRDLQGTVLDGHAHILQLCHAQKDEHAVKKAGKDKSSTKLLVRNVAFEATEKDLTQLFSPFGQVLERAKEGESLEELRARSL ARLAAQFTEEQNGFQNPAKLSKKRKDVTNLDQESMKFWRITD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G19610			nucleotide binding;nucleic aci...		Potri.001G081000 [exp]	0	1
AT3G04830			Protein prenylyltransferase su...		Potri.013G038501 [exp]	2.44	0.9224
AT1G05910			cell division cycle protein 48...		Potri.017G031150 [exp]	2.82	0.9163
AT3G18360			VQ motif-containing protein (....		Potri.012G055900 [exp]	6.70	0.8732
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Potri.015G065001 [exp]	8.48	0.9156
					Potri.001G020080 [exp]	13.41	0.8954
					Potri.002G161801 [exp]	14.07	0.9090
AT5G42920		AtTHO5	THO complex, subunit 5 (.1.2)		Potri.002G125300 [exp]	14.42	0.9130
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.006G269800 [exp]	15.19	0.8832
AT3G61050		AtCLB, NTMCTYPE...	calcium-dependent lipid-bindin...		Potri.014G072800 [exp]	16.06	0.8761
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Potri.004G121100 [exp]	18.24	0.9114

Compare expression of checked genes

Potri.001G081000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.