Plant FIBer expression Database

Potri.001G082000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16950 91 / 2e-25 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021093
[exp]
131 / 2e-41 AT5G16950 106 / 2e-31 unknown protein
Lus10026852
[exp]
129 / 1e-40 AT5G16950 104 / 8e-31 unknown protein
Lus10017219
[exp]
0 / 1 ND 40 / 5e-10
PFAM info
Representative CDS sequence
>Potri.001G082000.3 pacid=42790059 polypeptide=Potri.001G082000.3.p locus=Potri.001G082000 ID=Potri.001G082000.3.v4.1 annot-version=v4.1
ATGGTAACTGAAGAGCCAAAAGATCCATTCAAGGGGGTTGACTGGAAGGCCATAGGTGGTGAATTACAGAAGGATCCTAGCGCTGGTACTAAACCAATTA
TAAAGAAGCGGCTTCCGAAAAAGATTAGGCAAATTCCAGACTACTATTTCCTTCCTCGATTGCCTCTACCTACTGTCATTGCCTTCTATGGAGCGTGTAT
TGCAGGTGGAGTTGGTGCTGGCATGCTACTGGAGATGTGGATAAATAAGAAAGTGAAAGAGGATGGAGGCATCATATGGGAGTTTGATAAATAG
AA sequence
>Potri.001G082000.3 pacid=42790059 polypeptide=Potri.001G082000.3.p locus=Potri.001G082000 ID=Potri.001G082000.3.v4.1 annot-version=v4.1
MVTEEPKDPFKGVDWKAIGGELQKDPSAGTKPIIKKRLPKKIRQIPDYYFLPRLPLPTVIAFYGACIAGGVGAGMLLEMWINKKVKEDGGIIWEFDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G16950 unknown protein Potri.001G082000
[exp]
0 1
AT1G11400 PYM partner of Y14-MAGO (.1.2.3) Potri.003G021500
[exp]
5.38 0.8580
AT5G50460 secE/sec61-gamma protein trans... Potri.015G097300
[exp]
7.93 0.8749 SEC61.2
AT3G05560 Ribosomal L22e protein family ... Potri.010G012700
[exp]
11.04 0.8896 RPL22.5
AT5G02960 Ribosomal protein S12/S23 fami... Potri.016G085800
[exp]
21.14 0.8864 Pt-RPS23.5
AT4G23885 unknown protein Potri.003G140300
[exp]
26.38 0.8593
AT3G49100 Signal recognition particle, S... Potri.002G043600
[exp]
29.94 0.8377 SRP9.2
AT5G44710 unknown protein Potri.003G155000
[exp]
30.98 0.8626
AT5G51960 unknown protein Potri.008G044200
[exp]
31.01 0.8707
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.015G141900
[exp]
32.37 0.8801
AT1G26880 Ribosomal protein L34e superfa... Potri.004G029400
[exp]
32.40 0.8740

Potri.001G082000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.