Potri.001G086300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42000 273 / 2e-95 ORMDL family protein (.1.2)
AT1G01230 254 / 2e-88 ORMDL family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G144600 306 / 1e-108 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2)
Potri.014G101000 263 / 1e-91 AT1G01230 285 / 3e-100 ORMDL family protein (.1)
Potri.002G174400 263 / 2e-91 AT1G01230 254 / 3e-88 ORMDL family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033219 277 / 3e-97 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2)
Lus10023031 276 / 9e-97 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2)
Lus10005980 263 / 1e-91 AT1G01230 295 / 1e-104 ORMDL family protein (.1)
Lus10030232 248 / 9e-79 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Lus10003209 192 / 4e-64 AT5G42000 194 / 2e-65 ORMDL family protein (.1.2)
Lus10017314 189 / 2e-62 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2)
Lus10031614 83 / 2e-21 AT2G40190 81 / 1e-20 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04061 ORMDL ORMDL family
Representative CDS sequence
>Potri.001G086300.1 pacid=42793603 polypeptide=Potri.001G086300.1.p locus=Potri.001G086300 ID=Potri.001G086300.1.v4.1 annot-version=v4.1
ATGTACGTGAAAGCTGAGCCAGCGACAGATGTGAATAGGAACACGGAGTGGTTCACATATCCAGGAGTTTGGACAATTTATATGCTCATTGTTTGCATGT
CTTTGCTTCTTGTTCTTTCCATCTTTGGTTGTTCTGCTGGGATGGCCTGGACTATTGTCCATCTTTGTCATTTTGCTGTTACATATCACTTTTTTCACTG
GAAGAAGGGAACACCTTTTGCTGACGACCAGGGTATCTACAATGGATTGACTTGGTGGGAGCAAATAGAAAATGGCAAGCAACTCACACGCAACAGGAAG
TTTCTGACAGTTGTACCTGTAGTGCTGTATTTGATAGCCTCGCATACAACAGACTATCAAAACCCAATGCTCTTCTTCAACACATTGGCTGTATTTGTGC
TGGTTGTTGCTAAGTTCCCACACATGCACAAGGTTCGCATATTTGGAATCAATGCTGATCATTGA
AA sequence
>Potri.001G086300.1 pacid=42793603 polypeptide=Potri.001G086300.1.p locus=Potri.001G086300 ID=Potri.001G086300.1.v4.1 annot-version=v4.1
MYVKAEPATDVNRNTEWFTYPGVWTIYMLIVCMSLLLVLSIFGCSAGMAWTIVHLCHFAVTYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRK
FLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVLVVAKFPHMHKVRIFGINADH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42000 ORMDL family protein (.1.2) Potri.001G086300 0 1
AT1G65020 unknown protein Potri.013G079201 2.00 0.9235
AT3G13410 unknown protein Potri.001G000900 3.46 0.9260
AT4G15960 alpha/beta-Hydrolases superfam... Potri.010G010800 3.46 0.9054
AT4G20410 GAMMA-SNAP, GSN... gamma-soluble NSF attachment p... Potri.011G155200 4.69 0.8950 Pt-GSNAP.1
AT1G09150 pseudouridine synthase and arc... Potri.013G013700 9.94 0.8971
AT1G22520 Domain of unknown function (DU... Potri.019G079101 10.00 0.9010
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Potri.011G077900 10.00 0.9023
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.015G126301 12.96 0.8870
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Potri.010G157600 14.42 0.8921
AT4G31300 PBA1 N-terminal nucleophile aminohy... Potri.006G077900 14.69 0.9008 PBA1.2

Potri.001G086300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.