Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64585 48 / 2e-09 RTFL22, DVL12 DEVIL 12, ROTUNDIFOLIA like 22 (.1) AT1G13245 39 / 3e-06 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1) AT1G68825 37 / 2e-05 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT3G25717 37 / 2e-05 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1) AT3G55515 37 / 7e-05 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT1G67265 35 / 9e-05 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT2G39705 35 / 0.0002 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT3G46613 35 / 0.0009 RTFL4, DVL15 DEVIL 15, ROTUNDIFOLIA like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G173750 [exp] 53 / 2e-11 AT1G64585 44 / 3e-08 DEVIL 12, ROTUNDIFOLIA like 22 (.1) Potri.010G129600 [exp] 40 / 2e-06 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.008G116700 [exp] 40 / 2e-06 AT1G13245 76 / 6e-21 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.010G201700 [exp] 38 / 2e-05 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G057800 [exp] 38 / 3e-05 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.014G138900 [exp] 36 / 4e-05 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.004G102950 [exp] 35 / 9e-05 AT1G67265 64 / 4e-16 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.001G242800 [exp] 36 / 0.0001 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.003G073900 [exp] 35 / 0.0002 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034272 [exp] 42 / 6e-07 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 40 / 3e-06 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10023399 [exp] 36 / 0.0002 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10002705 [exp] 36 / 0.0002 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.001G087150.1 pacid=42791887 polypeptide=Potri.001G087150.1.p locus=Potri.001G087150 ID=Potri.001G087150.1.v4.1 annot-version=v4.1 ATGGAACTGTCTACTTCCCAGGGAAAGGAAGCTACTTCATCCACACAAAGGCAAACCAGAATTCAGGCAAAGAACAAGGCTTTGAAGGGGGCGAGGGCAA GGTTGTACATAATTTGCCGTTGTGTGGTCATGCTGCTTTGTTGGAAGGAGAGCAAAGATGAGTAA
AA sequence Show only first row Show all	>Potri.001G087150.1 pacid=42791887 polypeptide=Potri.001G087150.1.p locus=Potri.001G087150 ID=Potri.001G087150.1.v4.1 annot-version=v4.1 MELSTSQGKEATSSTQRQTRIQAKNKALKGARARLYIICRCVVMLLCWKESKDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64585		RTFL22, DVL12	DEVIL 12, ROTUNDIFOLIA like 22...		Potri.001G087150 [exp]	0	1
AT4G16630			DEA(D/H)-box RNA helicase fami...		Potri.002G020101 [exp]	12.84	0.8049
					Potri.004G071450 [exp]	14.00	0.8238
AT2G30580		BMI1A, DRIP2	DREB2A-interacting protein 2 (...		Potri.005G054100 [exp]	27.49	0.8107
					Potri.008G168200 [exp]	41.92	0.7171
AT5G05800			unknown protein		Potri.008G074066 [exp]	45.36	0.7995
AT1G64870			unknown protein		Potri.006G252800 [exp]	47.05	0.8072
					Potri.013G079400 [exp]	54.99	0.8028
AT5G20060			alpha/beta-Hydrolases superfam...		Potri.006G251100 [exp]	58.78	0.7929
AT4G00467			Calcium-dependent lipid-bindin...		Potri.014G084100 [exp]	84.90	0.7605
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023100 [exp]	85.73	0.7816

Compare expression of checked genes

Potri.001G087150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.