Potri.001G089300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13550 256 / 2e-88 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT2G16740 185 / 2e-60 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08690 183 / 5e-60 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT1G64230 180 / 1e-58 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G56150 179 / 4e-58 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G41700 179 / 4e-58 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G53300 176 / 6e-57 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 176 / 7e-57 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT3G08700 171 / 5e-55 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT1G16890 131 / 3e-39 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G083800 182 / 1e-59 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.001G094900 180 / 1e-58 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 179 / 2e-58 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 179 / 3e-58 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.012G033000 179 / 3e-58 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 179 / 3e-58 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.016G138900 179 / 4e-58 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 177 / 1e-57 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 177 / 1e-57 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028700 184 / 2e-60 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 184 / 2e-60 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10012931 201 / 5e-60 AT1G55320 1008 / 0.0 acyl-activating enzyme 18 (.1.2)
Lus10021385 180 / 1e-58 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 180 / 1e-58 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 180 / 1e-58 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10033937 179 / 3e-58 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10038827 179 / 4e-58 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 179 / 4e-58 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 179 / 5e-58 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Potri.001G089300.1 pacid=42789169 polypeptide=Potri.001G089300.1.p locus=Potri.001G089300 ID=Potri.001G089300.1.v4.1 annot-version=v4.1
ATGAATAGCCAAGGAGGCATCTCAATGGCAGGAGGTGGAGGATCATCAGCAACAGCAACAAGTTCTTGGGTATCACCATCATCAGTTTCAACATCAGGGA
AAAGAATACAACGAGAAATGACTGAACTTAACATGGACCCACCTCCTGATTGCTCTGCTGGACCCAAAGGTGATAATCTTTACCATTGGATCTCCACCGT
CATCGGGCCTCCAGGAACGCCATACCAAGGCGGAATATTTTTCCTTGACCTAACGTTTCCAAGTGATTATCCATTCAAACCTCCAAAGGTAGTGTTCAAG
ACTCGTATCTACCATTGCAATGTTGATTCTGCCGGCAACCTTAGTTTGGACATCCTGAAGGATAGTTGGAGTCCAGCTCTTACAATTACTAAAGTGCTAC
TTGCAATCAGATCGATTTTCACTCACCCTGATCCCTACAATCCTCTTGTCCCTGGCATTGCCCACTTGTACTTGGCAGATAGAGCAAAACATGATGAACT
AGCTGCAGAGTGGACACTGCGATTTGCGAAGTGA
AA sequence
>Potri.001G089300.1 pacid=42789169 polypeptide=Potri.001G089300.1.p locus=Potri.001G089300 ID=Potri.001G089300.1.v4.1 annot-version=v4.1
MNSQGGISMAGGGGSSATATSSWVSPSSVSTSGKRIQREMTELNMDPPPDCSAGPKGDNLYHWISTVIGPPGTPYQGGIFFLDLTFPSDYPFKPPKVVFK
TRIYHCNVDSAGNLSLDILKDSWSPALTITKVLLAIRSIFTHPDPYNPLVPGIAHLYLADRAKHDELAAEWTLRFAK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13550 EMB144, COP10, ... FUSCA 9, EMBRYO DEFECTIVE 144,... Potri.001G089300 0 1
AT1G76860 Small nuclear ribonucleoprotei... Potri.002G068800 2.44 0.8706
AT1G78420 RING/U-box superfamily protein... Potri.011G096000 7.74 0.8466
AT2G46580 Pyridoxamine 5'-phosphate oxid... Potri.002G173800 8.06 0.8283
AT1G76050 Pseudouridine synthase family ... Potri.002G016800 9.32 0.8650
AT2G13840 Polymerase/histidinol phosphat... Potri.001G206400 10.00 0.8609
AT4G39630 unknown protein Potri.007G085100 10.00 0.8151
AT5G10620 methyltransferases (.1) Potri.006G278500 10.00 0.8515
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Potri.007G071400 10.90 0.8465
AT1G76940 RNA-binding (RRM/RBD/RNP motif... Potri.015G009000 12.00 0.8238
AT3G57080 RPB5B, NRPE5 RNA POLYMERASE II FIFTH LARGES... Potri.016G038500 12.24 0.8304

Potri.001G089300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.