Potri.001G091500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64405 42 / 5e-06 unknown protein
AT4G23870 38 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G140100 181 / 1e-60 AT1G64405 42 / 5e-06 unknown protein
Potri.004G015900 42 / 5e-06 AT4G21920 55 / 1e-10 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003883 71 / 4e-17 ND /
Lus10001828 68 / 6e-16 ND 35 / 0.003
Lus10003882 64 / 2e-14 ND 35 / 0.004
Lus10023082 56 / 2e-11 ND /
Lus10023083 52 / 1e-09 ND 36 / 0.005
Lus10032385 47 / 1e-07 ND 39 / 1e-04
PFAM info
Representative CDS sequence
>Potri.001G091500.1 pacid=42789900 polypeptide=Potri.001G091500.1.p locus=Potri.001G091500 ID=Potri.001G091500.1.v4.1 annot-version=v4.1
ATGGGAAATTGCATAAAGCCTAGCACAAGAAGGCAGCATGAAGAGGATGATAACATGAAGGAGCTTCACCAGGAAAAGAAAGAACTAGAGTTCGTGAAGG
AAAGTGGTAACTTTGAGAAAGGTTCAAGTCTTAAGGTTAAGATCGTGCTTACAAAGGAGGAGCTAGAGTGGTTACTGTTTCAGCTAAAGGTCAATGGAGG
AAAGAAGCTAGAAGATGTCTTGGGAGAGATAGAGAGAGGGAGATCAATGAAAGTTAAGACATGGAAACCCTCTCTGGAGAGTATCATGGAAAGTCCTGAA
GGGCTTGAGAACGAGAGACGAGTCGTTTGA
AA sequence
>Potri.001G091500.1 pacid=42789900 polypeptide=Potri.001G091500.1.p locus=Potri.001G091500 ID=Potri.001G091500.1.v4.1 annot-version=v4.1
MGNCIKPSTRRQHEEDDNMKELHQEKKELEFVKESGNFEKGSSLKVKIVLTKEELEWLLFQLKVNGGKKLEDVLGEIERGRSMKVKTWKPSLESIMESPE
GLENERRVV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G64405 unknown protein Potri.001G091500 0 1
AT3G01420 PADOX-1, ALPHA-... plant alpha dioxygenase 1, alp... Potri.008G106400 8.00 0.7790 Pt-PIOX.1
AT3G63010 ATGID1B, GID1B GA INSENSITIVE DWARF1B, alpha/... Potri.002G213100 37.62 0.7727
AT3G04070 NAC ANAC047 NAC domain containing protein ... Potri.019G031400 41.67 0.7727
AT4G33565 RING/U-box superfamily protein... Potri.017G049300 45.23 0.7603
AT2G39110 Protein kinase superfamily pro... Potri.010G225300 51.14 0.7199
AT4G38540 FAD/NAD(P)-binding oxidoreduct... Potri.019G003600 64.37 0.7641
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Potri.004G012500 70.21 0.7518
AT5G23350 GRAM domain-containing protein... Potri.004G068150 87.89 0.7321
AT5G23370 GRAM domain-containing protein... Potri.004G068100 99.21 0.6993
Potri.006G198401 190.03 0.7085

Potri.001G091500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.