Plant FIBer expression Database

Potri.001G093401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G138300
[exp]
0 / 1 AT1G64350 457 / 4e-163 Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G093401.1 pacid=42787807 polypeptide=Potri.001G093401.1.p locus=Potri.001G093401 ID=Potri.001G093401.1.v4.1 annot-version=v4.1
ATGTCCAGACGTACGGCACGGAACTATTCATGGACTCCTGGGAGCGTTGAAAGGACAGTCAACAATGGAAACAGTGGTTCCTGGAAGATGATACAGGGGC
TAGGCTGTGGGTTCAAATGCAGCCTGTTCATGCCAAACCCCTTTCATGTTGGATTGCCACAATCTTACCACCCATCAGTTCCCGAGGTTGCTAAGGTCAT
CCCACTCATGTCCCATAATTCCATCTGCCATGAAGTGCATTAA
AA sequence
>Potri.001G093401.1 pacid=42787807 polypeptide=Potri.001G093401.1.p locus=Potri.001G093401 ID=Potri.001G093401.1.v4.1 annot-version=v4.1
MSRRTARNYSWTPGSVERTVNNGNSGSWKMIQGLGCGFKCSLFMPNPFHVGLPQSYHPSVPEVAKVIPLMSHNSICHEVH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G64350 SEH1H Transducin/WD40 repeat-like su... Potri.001G093401
[exp]
0 1
Potri.002G146901
[exp]
3.74 0.9700
AT2G47180 ATGOLS1 galactinol synthase 1 (.1) Potri.008G101000
[exp]
13.41 0.9699 Pt-GAS1.1
AT1G52565 unknown protein Potri.001G192800
[exp]
13.85 0.9831
AT2G15680 AtCML30 calmodulin-like 30, Calcium-bi... Potri.009G102500
[exp]
16.24 0.9645
Potri.001G248708
[exp]
17.74 0.9658
AT5G48100 LAC15, TT10, AT... TRANSPARENT TESTA 10, LACCASE-... Potri.005G200600
[exp]
19.28 0.9689
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Potri.014G019300
[exp]
21.49 0.9361
AT1G29640 Protein of unknown function, D... Potri.011G076900
[exp]
21.67 0.9742
AT4G15480 UGT84A1 UDP-Glycosyltransferase superf... Potri.009G095300
[exp]
21.90 0.9767
AT5G59910 HTB4 Histone superfamily protein (.... Potri.008G030600
[exp]
23.53 0.9274

Potri.001G093401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.