Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23630 314 / 2e-108 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) AT1G64090 311 / 1e-107 RTNLB3 Reticulan like protein B3 (.1.2) AT4G11220 311 / 3e-107 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) AT2G46170 297 / 4e-102 Reticulon family protein (.1.2) AT5G41600 294 / 6e-101 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) AT3G61560 282 / 4e-96 Reticulon family protein (.1.2) AT3G10260 224 / 3e-73 Reticulon family protein (.1.2.3) AT4G01230 216 / 2e-70 Reticulon family protein (.1) AT3G18260 189 / 3e-60 Reticulon family protein (.1) AT3G10915 133 / 4e-38 Reticulon family protein (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G133600 [exp] 387 / 9e-138 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.014G091200 [exp] 340 / 5e-119 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2) Potri.015G027300 [exp] 334 / 2e-116 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.012G035600 [exp] 326 / 2e-113 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.002G165400 [exp] 318 / 3e-110 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2) Potri.002G055600 [exp] 236 / 4e-78 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3) Potri.005G206800 [exp] 233 / 6e-77 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3) Potri.013G160900 [exp] 214 / 2e-69 AT4G11220 193 / 4e-61 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Potri.015G044300 [exp] 179 / 3e-56 AT3G18260 251 / 1e-84 Reticulon family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032313 [exp] 336 / 5e-117 AT4G23630 318 / 1e-109 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Lus10027548 [exp] 327 / 7e-114 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2) Lus10027546 [exp] 323 / 3e-112 AT4G11220 307 / 5e-106 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Lus10038833 [exp] 316 / 2e-109 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) Lus10014948 [exp] 313 / 2e-108 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Lus10039307 [exp] 313 / 4e-108 AT1G64090 307 / 4e-106 Reticulan like protein B3 (.1.2) Lus10036405 [exp] 309 / 1e-106 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2) Lus10041080 [exp] 308 / 2e-106 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2) Lus10028753 [exp] 315 / 8e-101 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3) Lus10017533 [exp] 284 / 1e-96 AT1G64090 303 / 9e-104 Reticulan like protein B3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0484 [poplar] [flax] Peroxisome PF02453 [poplar] [flax] Reticulon Reticulon
Representative CDS sequence Show only first row Show all	>Potri.001G097700.1 pacid=42791311 polypeptide=Potri.001G097700.1.p locus=Potri.001G097700 ID=Potri.001G097700.1.v4.1 annot-version=v4.1 ATGGCAGAGCATGATAAGGACGATTCAGTGGTTGAATCGGTGACGGAGAAGATATCGGAGAAGACCCACGGCCATGATTCATCATCGGTTTCTGATTCCG ATCACGAGAAATCGAAATCTAATCCCGATTCCCTCAAATCTAAGATTTATCGCCTTTTTGGCCGTGAAAAGCCTGTACACAAGGTTCTCGGTGGCGGCAA ACCTGCCGATGTTTTCCTATGGAGGAACAAGAAGATATCAGCAGGAGTGCTTGGTGGCGCAACTGCTATATGGGTTCTGTTTGAATTGCTTGAATACAAT CTTGTCACTTTGGTTTGCCACTGCTTGATCCTTGCTCTTGCATTACTGTTCTTGTGGTCTAATGCCTCCACCTTCATCAACAAGTCCCCACCACGCATCC CAGAAGTTTGTATTCCAGAGGAACCAGTTCTACAGACTGCAGCCGCACTTAGGATTGAGATCAATCAGGGTTTTTCTGTCCTGCGGGATATTGCATCAGG AAGGGATCTGAAGAATTTCCTCACTGTTATTGCTGGCTTATGGGTCTTGTCCATTGTTGGGAGCTGGTGCAACTTTGTGACCTTGTTCTACATTGCTTTT GTATTGCTCCACACTGTACCTGTCTTCTATGAGAAGTATGAGGATCAGGTAGATGCATTTGCGGAGAAGGCAATGATTGAGATCAAGAAGCAATATGCAG TTTTCGATGCCAAGGTTCTAAGTAAGATTCCTAGGGGGCCATTGAAGGATAAGAAAAGGGATTAG
AA sequence Show only first row Show all	>Potri.001G097700.1 pacid=42791311 polypeptide=Potri.001G097700.1.p locus=Potri.001G097700 ID=Potri.001G097700.1.v4.1 annot-version=v4.1 MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDSLKSKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYN LVTLVCHCLILALALLFLWSNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIAGLWVLSIVGSWCNFVTLFYIAF VLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKDKKRD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Potri.001G097700 [exp]	0	1
AT5G09310			unknown protein		Potri.005G063100 [exp]	9.38	0.7474
AT5G55340			MBOAT (membrane bound O-acyl t...		Potri.008G145700 [exp]	10.34	0.7775
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Potri.008G069200 [exp]	12.24	0.7698
AT1G16560			Per1-like family protein (.1.2...		Potri.015G136600 [exp]	15.09	0.7775
AT3G14080			Small nuclear ribonucleoprotei...		Potri.003G068400 [exp]	17.57	0.7034
AT3G61260			Remorin family protein (.1)		Potri.002G157700 [exp]	23.62	0.7085
AT5G65590	DOF	AtDof5,7	Dof-type zinc finger DNA-bindi...		Potri.007G058200 [exp]	25.49	0.7217
AT1G28310	DOF	AtDof1. 4	Dof-type zinc finger DNA-bindi...		Potri.004G046600 [exp]	25.57	0.7759
AT3G52880		ATMDAR1	monodehydroascorbate reductase...		Potri.006G114800 [exp]	27.92	0.6621	MDHAR1.1
AT1G61620			phosphoinositide binding (.1)		Potri.004G026800 [exp]	31.52	0.7664

Compare expression of checked genes

Potri.001G097700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.