Potri.001G100550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11340 45 / 4e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G036350 34 / 0.0007 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G100550.1 pacid=42789263 polypeptide=Potri.001G100550.1.p locus=Potri.001G100550 ID=Potri.001G100550.1.v4.1 annot-version=v4.1
ATGAACAAGGTCCGTGATGTTACTGCTGCTGCACTTGACAGGATTTCCAGGGGCACCAGGCCACTTCCAAAGAGAGGGCAGATAAAGTCAAGGATAGCAG
CAAATGCTTTCCACTCTATTGTTTCCGTGCTATCCAAAGCCTCTTCACATCAACATCATTCCCAGAGAAAAAGCTACCCGAGGAAGGCATAA
AA sequence
>Potri.001G100550.1 pacid=42789263 polypeptide=Potri.001G100550.1.p locus=Potri.001G100550 ID=Potri.001G100550.1.v4.1 annot-version=v4.1
MNKVRDVTAAALDRISRGTRPLPKRGQIKSRIAANAFHSIVSVLSKASSHQHHSQRKSYPRKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G100550 0 1
AT4G10790 UBX domain-containing protein ... Potri.003G145200 10.48 0.7352
AT5G33320 ARAPPT, CUE1 PHOSPHOENOLPYRUVATE/PHOSPHATE ... Potri.012G082100 22.97 0.6733
AT3G29770 ATMES11 ARABIDOPSIS THALIANA METHYL ES... Potri.017G096900 23.10 0.7718
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.001G335800 24.41 0.7751 GAPDH.2
AT4G19550 zinc ion binding;transcription... Potri.001G082800 27.82 0.7459
AT1G77780 Glycosyl hydrolase superfamily... Potri.005G172000 33.70 0.7715
AT2G37410 ATTIM17-2 TRANSLOCASE OF THE INNER MEMBR... Potri.006G164980 52.53 0.7329
Potri.007G106850 55.89 0.7329
AT1G65950 Protein kinase superfamily pro... Potri.004G075100 61.87 0.7266
AT5G55690 MADS MADS-box transcription factor ... Potri.001G329800 61.96 0.7254

Potri.001G100550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.