Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35785 97 / 1e-25 RNA-binding (RRM/RBD/RNP motifs) family protein AT1G07350 89 / 5e-23 SR45a serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G21440 59 / 1e-10 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 53 / 1e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G53460 53 / 1e-08 CP29 chloroplast RNA-binding protein 29 (.1.2.3.4) AT2G37510 49 / 6e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G10400 50 / 1e-07 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT1G60650 50 / 1e-07 AtRZ-1b AtRZ-1b, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT2G37220 50 / 1e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G52380 49 / 2e-07 CP33, PDE322 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G130301 [exp] 128 / 1e-37 AT4G35785 145 / 3e-43 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.009G041700 [exp] 100 / 1e-25 AT4G35785 139 / 6e-39 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.001G248100 [exp] 98 / 6e-25 AT1G07350 125 / 2e-35 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.005G105700 [exp] 96 / 7e-25 AT4G35785 158 / 4e-48 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.012G038200 [exp] 56 / 6e-10 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 52 / 6e-09 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 51 / 2e-08 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.016G010200 [exp] 52 / 3e-08 AT3G07810 413 / 2e-140 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.006G208500 [exp] 50 / 3e-08 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017507 [exp] 112 / 3e-31 AT4G35785 123 / 4e-35 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10028776 [exp] 101 / 5e-27 AT4G35785 127 / 5e-36 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10041854 [exp] 100 / 1e-26 AT4G35785 179 / 6e-56 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10028400 [exp] 99 / 4e-26 AT4G35785 181 / 2e-57 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10040705 [exp] 98 / 1e-24 AT1G07350 163 / 2e-46 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10018202 [exp] 95 / 4e-23 AT1G07350 145 / 1e-41 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10040854 [exp] 65 / 3e-14 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10005891 [exp] 64 / 2e-12 AT3G45980 230 / 1e-76 HISTONE H2B, Histone superfamily protein (.1) Lus10021035 [exp] 57 / 1e-09 AT3G15010 182 / 4e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10023817 [exp] 56 / 2e-09 AT3G15010 188 / 5e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G101500.2 pacid=42788262 polypeptide=Potri.001G101500.2.p locus=Potri.001G101500 ID=Potri.001G101500.2.v4.1 annot-version=v4.1 ATGACCATCCTTAGGCCTGATTCGCCACGCAATTCAGGTTCACCAGGCAGAGGCCGGCGGTCAAGATCGTTGTCAAGGCCCCGTCGAAGTCGCTCCAGGA GTATCAATGGTTCTGGTATAACCGGATTATCAACTAGGATCACAAGCAGTGATCTTGAGAAGTATTTTAACAGTGAAGGGAAGGTTTTGGAGTGTCATCT GGTAACAGATCCTGACACCAGAGAATTTCGTGGATTTGCTTTTGTTACCGTGGAAACCACTGAGGATGCTGACCGTTGCATCAAGTATTTGAATTGTTCA GTGCTTGAAGGACGACTGATCACCATGGAAAAGATGGCAGACCCAAACAAATGCCTTTCACGCTGTATAAACTGGCGGAATTTCGGAGGGGGAATGAATG ACCCACCATGGAAGAAGCATTCATTTATGAAAATGAACCTTGTATCAATCTTGGCTCATATCCAATTGAATGCAGCCTGGCTGTAA
AA sequence Show only first row Show all	>Potri.001G101500.2 pacid=42788262 polypeptide=Potri.001G101500.2.p locus=Potri.001G101500 ID=Potri.001G101500.2.v4.1 annot-version=v4.1 MTILRPDSPRNSGSPGRGRRSRSLSRPRRSRSRSINGSGITGLSTRITSSDLEKYFNSEGKVLECHLVTDPDTREFRGFAFVTVETTEDADRCIKYLNCS VLEGRLITMEKMADPNKCLSRCINWRNFGGGMNDPPWKKHSFMKMNLVSILAHIQLNAAWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Potri.001G101500 [exp]	0	1
AT1G13080		CYP71B2	"cytochrome P450, family 71, s...		Potri.015G028000 [exp]	2.23	0.9158
AT3G60390	HD	HAT3	homeobox-leucine zipper protei...		Potri.002G136400 [exp]	4.24	0.9078	Pt-ATHB.8
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.016G105900 [exp]	4.69	0.8842
AT2G31130			unknown protein		Potri.004G055300 [exp]	5.47	0.8884
AT4G03230			S-locus lectin protein kinase ...		Potri.019G119900 [exp]	6.32	0.9023
AT4G00950		MEE47	maternal effect embryo arrest ...		Potri.014G100200 [exp]	8.83	0.8696
					Potri.003G026650 [exp]	12.84	0.8453
AT1G10480	C2H2ZnF	ZFP5	zinc finger protein 5 (.1)		Potri.010G036400 [exp]	15.81	0.8973	Pt-ZFP5.2
AT4G25410	bHLH	bHLH126	basic helix-loop-helix (bHLH) ...		Potri.012G132100 [exp]	16.09	0.8971
AT5G22355			Cysteine/Histidine-rich C1 dom...		Potri.016G047200 [exp]	17.20	0.8616

Compare expression of checked genes

Potri.001G101500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.