Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	UBC4.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41340 292 / 4e-102 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1) AT1G63800 290 / 1e-101 UBC5 ubiquitin-conjugating enzyme 5 (.1) AT2G46030 272 / 2e-94 UBC6 ubiquitin-conjugating enzyme 6 (.1) AT3G08690 94 / 1e-24 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G41700 91 / 2e-23 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT5G53300 91 / 2e-23 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT1G64230 91 / 2e-23 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G56150 90 / 4e-23 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT2G02760 90 / 6e-23 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT4G27960 89 / 6e-23 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G129700 [exp] 323 / 9e-115 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1) Potri.002G161000 [exp] 307 / 2e-108 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1) Potri.014G086600 [exp] 303 / 2e-106 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1) Potri.015G073400 [exp] 272 / 3e-94 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1) Potri.012G104100 [exp] 96 / 5e-25 AT5G50870 334 / 1e-118 ubiquitin-conjugating enzyme 27 (.1.2) Potri.019G083800 [exp] 93 / 3e-24 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2) Potri.011G168200 [exp] 91 / 2e-23 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G111400 [exp] 91 / 3e-23 AT1G78870 311 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.013G064400 [exp] 91 / 3e-23 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014763 [exp] 291 / 7e-102 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1) Lus10036372 [exp] 282 / 4e-98 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1) Lus10032274 [exp] 280 / 9e-98 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1) Lus10002359 [exp] 275 / 3e-95 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1) Lus10042136 [exp] 261 / 6e-90 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1) Lus10024638 [exp] 236 / 7e-80 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1) Lus10009422 [exp] 92 / 1e-23 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 92 / 1e-23 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10022726 [exp] 91 / 2e-23 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 91 / 2e-23 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.001G101900.1 pacid=42787728 polypeptide=Potri.001G101900.1.p locus=Potri.001G101900 ID=Potri.001G101900.1.v4.1 annot-version=v4.1 ATGTCTTCACCAAGCAAACGCAGGGAGATGGATTTGATGAAACTGATGATGAGTGATTACAAAGTGGAAATGATCAATGATGGCATGCAAGAGTTTTATG TGGAATTCAATGGACCTAAAGAAAGTCTTTATCAAGGAGGTGTGTGGAAGATAAGAGTCGAATTGCCAGATGCTTATCCTTACAAATCTCCATCAATTGG CTTTGTCAACAAGATCTATCACCCAAACGTTGATGAAATGTCTGGTTCGGTGTGTTTGGATGTTATCAACCAAACTTGGAGCCCCATGTTTGATCTGGTA AATGTATTTGAAGTATTTCTCCCTCAGCTACTTTTGTATCCAAATGCATCAGATCCATTGAATGGAGAAGCTGCTGCTTTGATGATGCGTGATCACACTG CTTACGATCAAAGAGTGAAAGAATATTGTGAGAAATATGCGAAGCCAGAGGATATAGGGGCAAAACCAGAAGAAAAATCCAGTGATGAAGAGCTGAGTGA AGATGATTACAACTCTGATGATGACCAAGTCGCTGGCAAAGCCGATCCTTGA
AA sequence Show only first row Show all	>Potri.001G101900.1 pacid=42787728 polypeptide=Potri.001G101900.1.p locus=Potri.001G101900 ID=Potri.001G101900.1.v4.1 annot-version=v4.1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLV NVFEVFLPQLLLYPNASDPLNGEAAALMMRDHTAYDQRVKEYCEKYAKPEDIGAKPEEKSSDEELSEDDYNSDDDQVAGKADP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41340		ATUBC4, UBC4	ubiquitin conjugating enzyme 4...		Potri.001G101900 [exp]	0	1	UBC4.4
AT3G58170		ATBET11, ATBS14...	ARABIDOPSIS THALIANA BET1P/SFT...		Potri.005G221600 [exp]	5.09	0.7521	BET11.1
AT5G47310			PPPDE putative thiol peptidase...		Potri.003G080300 [exp]	6.32	0.7085
AT4G26060			Ribosomal protein L18ae family...		Potri.001G198700 [exp]	8.66	0.7219
AT3G51610		NPU	NO PRIMEXINE AND PLASMA MEMBRA...		Potri.016G134700 [exp]	14.38	0.7316
AT5G05800			unknown protein		Potri.004G135901 [exp]	16.73	0.6853
AT1G55300		TAF7	TBP-associated factor 7 (.1.2)		Potri.003G218700 [exp]	25.09	0.6768
AT1G13380			Protein of unknown function (D...		Potri.010G124800 [exp]	25.98	0.7032
AT5G58575			unknown protein		Potri.001G279700 [exp]	26.00	0.6862
AT4G13720			Inosine triphosphate pyrophosp...		Potri.001G052400 [exp]	27.05	0.6895
AT2G25950			Protein of unknown function (D...		Potri.018G056100 [exp]	31.14	0.5991

Compare expression of checked genes

Potri.001G101900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.