Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12770 199 / 4e-62 ISE1, EMB1586 INCREASED SIZE EXCLUSION LIMIT 1, embryo defective 1586, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G12700 117 / 3e-31 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G54270 87 / 8e-21 EIF4A-2 eif4a-2 (.1.2) AT3G13920 87 / 1e-20 RH4, TIF4A1, EIF4A1 eukaryotic translation initiation factor 4A1 (.1.2.3.4) AT1G72730 86 / 3e-20 DEA(D/H)-box RNA helicase family protein (.1) AT3G19760 82 / 4e-19 EIF4A-III eukaryotic initiation factor 4A-III (.1) AT3G22330 79 / 1e-17 ATRH53, PMH2 putative mitochondrial RNA helicase 2 (.1) AT3G22310 77 / 2e-17 ATRH9, PMH1 RNA HELICASE 9, putative mitochondrial RNA helicase 1 (.1) AT2G42520 73 / 8e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G16280 73 / 9e-16 SWA3, AtRH36 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G123600 [exp] 208 / 1e-65 AT1G12770 711 / 0.0 INCREASED SIZE EXCLUSION LIMIT 1, embryo defective 1586, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G061050 [exp] 86 / 2e-20 AT3G13920 793 / 0.0 eukaryotic translation initiation factor 4A1 (.1.2.3.4) Potri.006G225700 [exp] 85 / 3e-20 AT3G13920 797 / 0.0 eukaryotic translation initiation factor 4A1 (.1.2.3.4) Potri.003G043700 [exp] 85 / 5e-20 AT3G13920 791 / 0.0 eukaryotic translation initiation factor 4A1 (.1.2.3.4) Potri.001G197900 [exp] 84 / 8e-20 AT3G13920 786 / 0.0 eukaryotic translation initiation factor 4A1 (.1.2.3.4) Potri.005G093900 [exp] 81 / 9e-19 AT3G19760 693 / 0.0 eukaryotic initiation factor 4A-III (.1) Potri.007G070000 [exp] 79 / 4e-18 AT3G19760 689 / 0.0 eukaryotic initiation factor 4A-III (.1) Potri.006G249100 [exp] 77 / 3e-17 AT5G60990 619 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Potri.016G061900 [exp] 76 / 6e-17 AT2G42520 786 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010686 [exp] 172 / 8e-52 AT1G12770 647 / 0.0 INCREASED SIZE EXCLUSION LIMIT 1, embryo defective 1586, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10017407 [exp] 77 / 2e-17 AT3G19760 728 / 0.0 eukaryotic initiation factor 4A-III (.1) Lus10040975 [exp] 76 / 4e-17 AT3G19760 494 / 1e-176 eukaryotic initiation factor 4A-III (.1) Lus10001057 [exp] 76 / 9e-17 AT5G26742 919 / 0.0 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3) Lus10035410 [exp] 76 / 1e-16 AT3G22330 692 / 0.0 putative mitochondrial RNA helicase 2 (.1) Lus10001425 [exp] 76 / 1e-16 AT5G26742 859 / 0.0 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3) Lus10031012 [exp] 76 / 1e-16 AT3G22330 690 / 0.0 putative mitochondrial RNA helicase 2 (.1) Lus10010206 [exp] 75 / 2e-16 AT3G19760 717 / 0.0 eukaryotic initiation factor 4A-III (.1) Lus10031761 [exp] 74 / 3e-16 AT5G60990 679 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10031182 [exp] 74 / 3e-16 AT5G60990 674 / 0.0 DEA(D/H)-box RNA helicase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00271 [poplar] [flax] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.001G102501.9 pacid=42790098 polypeptide=Potri.001G102501.9.p locus=Potri.001G102501 ID=Potri.001G102501.9.v4.1 annot-version=v4.1 ATGAACCATACAAGGCAGCTAAAAGATGTTGTCTTCAAACTAGAGGCTCGTGGGATGAATGCTGCAGAGCTCCATGGAGATCTTGGCAAGCTTGGTAGGT CGACAATTTTAAAGAAATTTAAAGGTGGCCAGGAGAGAGTTCTCATAACGAATGAACTTGCAGCAAGGGGTCCGGATGTTCCAGAGTGTGATCTTGTTGT CAATCTTGACCTGCCTACGGACTCAATTCATTATGCACATCAAGCTGGCAGGACTGGCCGGCTTGGTAGGAAGGGCACTGTGGTGACAATTTGCGAGGAG CCAGGAATGTTTGTTGTGAAGAAACTGCAGAAGCAGCTGGAGTCTATATTCCTGCATGCGAGTTTACAAAGGGCAAGCTTGTTGTCACTGAAGAAGGGAA GAAACATGCGGAGGCCTTGA
AA sequence Show only first row Show all	>Potri.001G102501.9 pacid=42790098 polypeptide=Potri.001G102501.9.p locus=Potri.001G102501 ID=Potri.001G102501.9.v4.1 annot-version=v4.1 MNHTRQLKDVVFKLEARGMNAAELHGDLGKLGRSTILKKFKGGQERVLITNELAARGPDVPECDLVVNLDLPTDSIHYAHQAGRTGRLGRKGTVVTICEE PGMFVVKKLQKQLESIFLHASLQRASLLSLKKGRNMRRP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12770		ISE1, EMB1586	INCREASED SIZE EXCLUSION LIMIT...		Potri.001G102501 [exp]	0	1
AT1G11900			Tetratricopeptide repeat (TPR)...		Potri.001G273100 [exp]	1.73	0.8948
AT1G71420			Tetratricopeptide repeat (TPR)...		Potri.013G098800 [exp]	5.09	0.8770
AT5G01110			Tetratricopeptide repeat (TPR)...		Potri.014G052800 [exp]	5.19	0.8732
AT5G08490		SLG1	SLOW GROWTH 1, Tetratricopepti...		Potri.004G134300 [exp]	7.41	0.8626
AT4G08210			Pentatricopeptide repeat (PPR-...		Potri.002G087400 [exp]	9.38	0.8661
AT3G23330			Tetratricopeptide repeat (TPR)...		Potri.001G186500 [exp]	14.42	0.8484
AT5G61800			Pentatricopeptide repeat (PPR)...		Potri.012G110800 [exp]	17.32	0.8496
AT5G52630		MEF1	mitochondrial RNAediting facto...		Potri.016G053500 [exp]	17.88	0.8415
AT1G56570		PGN	PENTATRICOPEPTIDE REPEAT PROTE...		Potri.013G006700 [exp]	17.88	0.7977
AT3G26540			Tetratricopeptide repeat (TPR)...		Potri.002G075300 [exp]	18.16	0.8386

Compare expression of checked genes

Potri.001G102501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.