Potri.001G103000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11410 447 / 3e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT4G23420 421 / 3e-149 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
AT4G23430 418 / 8e-148 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
AT5G02540 343 / 4e-118 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G37540 341 / 2e-117 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT5G50130 279 / 1e-92 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
AT4G24050 278 / 2e-92 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT1G64590 228 / 8e-73 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT5G54190 113 / 2e-28 PORA protochlorophyllide oxidoreductase A (.1.2)
AT4G27440 109 / 3e-27 PORB protochlorophyllide oxidoreductase B (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G128700 449 / 2e-160 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.003G128800 422 / 2e-149 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Potri.012G143800 404 / 2e-142 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Potri.015G146600 392 / 2e-137 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Potri.012G143600 391 / 1e-136 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Potri.006G083900 348 / 4e-120 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.012G087800 286 / 2e-95 AT5G50130 426 / 4e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Potri.T124508 283 / 1e-94 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Potri.015G081102 283 / 1e-94 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035481 461 / 6e-165 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Lus10031101 458 / 1e-163 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Lus10024647 442 / 3e-157 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10028781 437 / 3e-155 AT4G11410 470 / 3e-168 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10032282 427 / 1e-151 AT4G23430 459 / 8e-164 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Lus10035480 422 / 3e-149 AT4G11410 444 / 5e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10035479 422 / 9e-149 AT4G11410 444 / 2e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10032281 420 / 1e-148 AT4G11410 447 / 2e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10032280 424 / 2e-148 AT4G11410 461 / 5e-163 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10024648 418 / 6e-148 AT4G23430 447 / 2e-159 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF08659 KR KR domain
Representative CDS sequence
>Potri.001G103000.1 pacid=42789680 polypeptide=Potri.001G103000.1.p locus=Potri.001G103000 ID=Potri.001G103000.1.v4.1 annot-version=v4.1
ATGTGGCTTTTTGGATGGAAAGGGCCGTCTGGGTTCTCAGCCTCTTCTACAGCAGAGGAAGTTACACAAGGGATTGATGGAACTGGTCTTACTGCCATTG
TTACAGGAGCATCAAGTGGCATTGGTGCAGAGACAACGCGTGTCCTTGCACTGCGTGGTGTCCATGTAGTTATGGCAGTGCGGAATCTGGATGCTGGTAG
GAATGGCAAAGAAGCAATGCTCAAGGAAATCCCCAAAGCTGAGATTGATGTCATGGAGTTAGACCTAAGCTCAATGGCATCAGTGAGGAATTTCGCATCT
GAATATACGTCCTTGGGTCTTCCTTTGAACATTCTCATTAATAATGCAGGGGTTCTGTCATCTCCTTCCAAGCTTTCTCAAGATAACATTGAGCTGTTAT
TTGCAACCAACCATATAGGTCATTTTCTGTTGACAAACCTTTTATTGGAGATCATGAAAAACACAGCACAAAAAAGCAAGCAAGAAGGAAGGATCATTAA
TGTATCATCAGTAGGTCACCGAATAGTGACTCGTGAAGGGATTTGTTTCGATAAAATCTATAACGAGGCGAGTTGGTTTTCTTATGGACAATCAAAGCTT
GCTAACATATTGCACGCCAGTGAGCTTGCAAGGCGGCTGAAGGAAGAAGGGGAAGAGATAACTGCTAATTCACTACATCCCGGAGCAATCCATACCAATC
TTCTGCGTCACCAGGGTTTTGTTAATGCTATTTTCAGCTTGTTCGGTAAATACATGACAAAAAATGTTCAGCAGGGAGCAGCAACTACATGCTACATTGC
ATTGCATCCACAAGTTAAAGGGATGAGTGGAAACTATTTTATGGACAGTAACATAGCAGAACCAAGCTCTCAGGCCAAAGATGCAGAATTGGCCAAAAAG
CTCTGGGATTTCAGCTTGATCATCACTGACAAAAAATAG
AA sequence
>Potri.001G103000.1 pacid=42789680 polypeptide=Potri.001G103000.1.p locus=Potri.001G103000 ID=Potri.001G103000.1.v4.1 annot-version=v4.1
MWLFGWKGPSGFSASSTAEEVTQGIDGTGLTAIVTGASSGIGAETTRVLALRGVHVVMAVRNLDAGRNGKEAMLKEIPKAEIDVMELDLSSMASVRNFAS
EYTSLGLPLNILINNAGVLSSPSKLSQDNIELLFATNHIGHFLLTNLLLEIMKNTAQKSKQEGRIINVSSVGHRIVTREGICFDKIYNEASWFSYGQSKL
ANILHASELARRLKEEGEEITANSLHPGAIHTNLLRHQGFVNAIFSLFGKYMTKNVQQGAATTCYIALHPQVKGMSGNYFMDSNIAEPSSQAKDAELAKK
LWDFSLIITDKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G11410 NAD(P)-binding Rossmann-fold s... Potri.001G103000 0 1
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.007G075900 2.64 0.9985
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Potri.010G131300 3.46 0.9985
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.007G076000 4.58 0.9984
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.007G076100 5.29 0.9983
AT1G59740 Major facilitator superfamily ... Potri.005G001400 10.95 0.9968
AT5G59100 Subtilisin-like serine endopep... Potri.010G196800 12.64 0.9961
AT1G11310 PMR2, ATMLO2, M... POWDERY MILDEW RESISTANT 2, MI... Potri.005G254300 12.84 0.9955
AT1G09910 Rhamnogalacturonate lyase fami... Potri.011G006200 13.74 0.9960
Potri.007G145600 14.49 0.9932
AT5G67360 ARA12 Subtilase family protein (.1) Potri.014G026600 15.49 0.9954

Potri.001G103000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.