Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63460 284 / 4e-99 ATGPX8 glutathione peroxidase 8 (.1) AT4G11600 265 / 1e-90 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT4G31870 234 / 1e-78 ATGPX7 glutathione peroxidase 7 (.1) AT2G25080 225 / 7e-75 ATGPX1 glutathione peroxidase 1 (.1) AT2G31570 222 / 7e-75 ATGPX2 glutathione peroxidase 2 (.1) AT2G43350 222 / 4e-74 ATGPX3 glutathione peroxidase 3 (.1.2) AT3G63080 216 / 3e-72 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT2G48150 214 / 2e-71 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G105200 [exp] 276 / 3e-96 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1) Potri.003G126100 [exp] 271 / 2e-93 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.007G126600 [exp] 240 / 2e-81 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1) Potri.006G265400 [exp] 231 / 3e-77 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.014G138800 [exp] 214 / 2e-71 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1) Potri.018G017500 [exp] 151 / 9e-47 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008023 [exp] 281 / 9e-97 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1) Lus10000601 [exp] 274 / 3e-95 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1) Lus10008022 [exp] 273 / 9e-95 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10008537 [exp] 272 / 2e-94 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008499 [exp] 273 / 6e-94 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10027021 [exp] 239 / 1e-81 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1) Lus10000603 [exp] 236 / 2e-80 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1) Lus10042418 [exp] 236 / 2e-79 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1) Lus10026887 [exp] 229 / 2e-76 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1) Lus10029651 [exp] 220 / 8e-74 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00578 [poplar] [flax] AhpC-TSA AhpC/TSA family
Representative CDS sequence Show only first row Show all	>Potri.001G105100.5 pacid=42788457 polypeptide=Potri.001G105100.5.p locus=Potri.001G105100 ID=Potri.001G105100.5.v4.1 annot-version=v4.1 ATGATTCCATCTCATTTACTGCTTCTTCACTTGCTTCTCTCTGCCTCTTTAGCTTCTTCAATGGCAACCCAAACCTCAAAGAACCCAGAATCAGTCCATG ACTTCACTATCAAGGATGCTAAGGAAAATGATGTGGATCTTAGCATTTTCAAGGGAAAAGTGTTGCTGATTGTTAATGTTGCTTCAAAATGTGGGATGAC CAACTCAAATTACGCTGAAATGAATCAATTATATGAGAAGTACAAAGATCAAGGACTAGAGATACTGGCATTTCCATGCAATCAGTTTGGTGAGGAGGAA CCAGGAACTAATGATCAGATCACAGACTTTGTCTGCACTCGCTTCAAATCAGAATTTCCCATCTTTGACAAGATTGATGTAAATGGTGAGAATGCTTCTC CACTGTACAAGTTCTTGAAGTTGGGGAAATGGGGAATTTTTGGTGATGATATTCAGTGGAACTTCGCTAAGTTCCTTGTCAACAAGGATGGCCAAGTTGT TGATCGTTACTACCCCACAACTTCACCTCTTAGTCTTGAGCGTGACATAAAGCAACTGCTGGAGATCTCATGA
AA sequence Show only first row Show all	>Potri.001G105100.5 pacid=42788457 polypeptide=Potri.001G105100.5.p locus=Potri.001G105100 ID=Potri.001G105100.5.v4.1 annot-version=v4.1 MIPSHLLLLHLLLSASLASSMATQTSKNPESVHDFTIKDAKENDVDLSIFKGKVLLIVNVASKCGMTNSNYAEMNQLYEKYKDQGLEILAFPCNQFGEEE PGTNDQITDFVCTRFKSEFPIFDKIDVNGENASPLYKFLKLGKWGIFGDDIQWNFAKFLVNKDGQVVDRYYPTTSPLSLERDIKQLLEIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Potri.001G105100 [exp]	0	1
AT3G17020			Adenine nucleotide alpha hydro...		Potri.010G144100 [exp]	1.41	0.8395
AT2G34190			Xanthine/uracil permease famil...		Potri.004G058800 [exp]	3.00	0.8530
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Potri.013G041300 [exp]	9.48	0.7557	IAA8.2
AT1G23170			Protein of unknown function DU...		Potri.017G124300 [exp]	10.14	0.7323
AT1G04280			P-loop containing nucleoside t...		Potri.008G162400 [exp]	10.67	0.8079
AT3G08840			D-alanine--D-alanine ligase fa...		Potri.006G106000 [exp]	14.38	0.7424
AT5G45540			Protein of unknown function (D...		Potri.015G116600 [exp]	15.00	0.8111
AT5G17410			Spc97 / Spc98 family of spindl...		Potri.010G180700 [exp]	17.32	0.7500
AT5G28150			Plant protein of unknown funct...		Potri.013G038000 [exp]	17.32	0.7688
AT1G26520			Cobalamin biosynthesis CobW-li...		Potri.008G094100 [exp]	18.65	0.7057

Compare expression of checked genes

Potri.001G105100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.