Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrcGpx3_1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11600 298 / 3e-104 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT4G31870 255 / 2e-87 ATGPX7 glutathione peroxidase 7 (.1) AT2G25080 246 / 1e-83 ATGPX1 glutathione peroxidase 1 (.1) AT1G63460 241 / 1e-82 ATGPX8 glutathione peroxidase 8 (.1) AT2G31570 239 / 8e-82 ATGPX2 glutathione peroxidase 2 (.1) AT3G63080 236 / 2e-80 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT2G43350 236 / 5e-80 ATGPX3 glutathione peroxidase 3 (.1.2) AT2G48150 231 / 9e-79 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G126100 [exp] 320 / 1e-112 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.001G105100 [exp] 276 / 3e-96 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1) Potri.007G126600 [exp] 254 / 2e-87 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1) Potri.006G265400 [exp] 253 / 2e-86 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.014G138800 [exp] 238 / 2e-81 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1) Potri.018G017500 [exp] 171 / 4e-55 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008499 [exp] 309 / 1e-108 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10008537 [exp] 307 / 1e-108 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008022 [exp] 305 / 7e-108 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10000603 [exp] 261 / 1e-90 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1) Lus10042418 [exp] 258 / 2e-88 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1) Lus10026887 [exp] 255 / 5e-87 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1) Lus10027021 [exp] 245 / 5e-84 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1) Lus10008023 [exp] 247 / 8e-84 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1) Lus10000601 [exp] 244 / 1e-83 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1) Lus10029651 [exp] 240 / 3e-82 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00578 [poplar] [flax] AhpC-TSA AhpC/TSA family
Representative CDS sequence Show only first row Show all	>Potri.001G105200.1 pacid=42789771 polypeptide=Potri.001G105200.1.p locus=Potri.001G105200 ID=Potri.001G105200.1.v4.1 annot-version=v4.1 ATGGCTAGCCAATCCAGTGCTCAATCAGTTCATGATTTCACTGTTAAGGATGCTAGGGAAAATGATGTTGACCTCAGCATATATAAGGGGAAGGTCCTCT TGATTGTCAATGTTGCTTCACAATGTGGCTTGACCAATTCAAACTACACGGAGTTGACCCAGCTATATGACAAATACAGGGATCAAGGTTTGGAGATTCT GGCTTTTCCATGCAATCAGTTTGGATCTCAGGAGCCAGGGAACAATGAACAAATAGTGGAGTTTGCTTGTACTCGCTTTAAGGCTGACTATCCCATATTT GATAAGGTTGACGTGAATGGTAAGAATGCTGCTCCAATTTACAAGTTCTTGAAGTCTAGCAAGGGTGGACTTTTTGGGGACAGCATCAAATGGAACTTTT CCAAGTTCCTGGTGGATAAAGATGGCAAAGTTGTGGATCGTTATGCTCCCACTACTTCCCCTCTTAGCATTGAGAAAGATGTCAAGAAACTACTGGGGAT TGCTTAA
AA sequence Show only first row Show all	>Potri.001G105200.1 pacid=42789771 polypeptide=Potri.001G105200.1.p locus=Potri.001G105200 ID=Potri.001G105200.1.v4.1 annot-version=v4.1 MASQSSAQSVHDFTVKDARENDVDLSIYKGKVLLIVNVASQCGLTNSNYTELTQLYDKYRDQGLEILAFPCNQFGSQEPGNNEQIVEFACTRFKADYPIF DKVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKDVKKLLGIA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Potri.001G105200 [exp]	0	1	PtrcGpx3_1
AT4G38810			Calcium-binding EF-hand family...		Potri.004G166900 [exp]	2.44	0.9154
AT4G03410			Peroxisomal membrane 22 kDa (M...		Potri.019G103200 [exp]	4.89	0.9229
AT1G51920			unknown protein		Potri.001G172850 [exp]	5.09	0.9158
AT4G11570			Haloacid dehalogenase-like hyd...		Potri.001G104366 [exp]	7.74	0.9142
AT2G17350			unknown protein		Potri.009G169200 [exp]	14.14	0.9013
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Potri.015G022100 [exp]	14.49	0.9104
AT3G14390			Pyridoxal-dependent decarboxyl...		Potri.005G246300 [exp]	14.79	0.8379
AT2G35840			Sucrose-6F-phosphate phosphohy...		Potri.016G066100 [exp]	16.73	0.8882	Pt-SPP1.2
AT5G49940		ATCNFU2, NFU2	CHLOROPLAST-LOCALIZED NIFU-LIK...		Potri.003G009300 [exp]	18.52	0.9091
AT5G15640			Mitochondrial substrate carrie...		Potri.017G098500 [exp]	27.27	0.7872

Compare expression of checked genes

Potri.001G105200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.