Pt-ADF.9 (Potri.001G106200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ADF.9
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00680 234 / 7e-81 ADF8 actin depolymerizing factor 8 (.1)
AT1G01750 233 / 2e-80 ADF11 actin depolymerizing factor 11 (.1)
AT5G52360 232 / 4e-80 ADF10 actin depolymerizing factor 10 (.1)
AT4G25590 231 / 1e-79 ADF7 actin depolymerizing factor 7 (.1)
AT5G59890 230 / 3e-79 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46010 228 / 2e-78 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT3G46000 223 / 2e-76 ADF2 actin depolymerizing factor 2 (.1)
AT5G59880 221 / 1e-75 ADF3 actin depolymerizing factor 3 (.1.2)
AT2G31200 187 / 4e-62 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT2G16700 173 / 1e-56 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G125500 271 / 2e-95 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
Potri.001G236700 243 / 3e-84 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 240 / 4e-83 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 239 / 1e-82 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 238 / 1e-82 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 236 / 9e-82 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.012G141600 234 / 1e-80 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Potri.015G144500 233 / 2e-80 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Potri.010G208500 226 / 8e-78 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024418 235 / 3e-81 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10024417 231 / 1e-79 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 231 / 1e-79 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10027474 231 / 2e-79 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Lus10014977 221 / 8e-76 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10038859 221 / 1e-75 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10039229 216 / 8e-74 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10023428 223 / 4e-73 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10040307 219 / 1e-72 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10008489 211 / 9e-72 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Potri.001G106200.1 pacid=42791560 polypeptide=Potri.001G106200.1.p locus=Potri.001G106200 ID=Potri.001G106200.1.v4.1 annot-version=v4.1
ATGGCGAATTCAGCATCTGGAATGGCTGTTGATGACGAGTGTAAGCTGAGGTTCATGGAACTTAAAGCAAAAAGGAGCCACCGATTTATCGTTTTCAAGA
TTGAAGAAAAGATCCAACAGGTGGTGGTGGAGACATTGGGAGAACCTCAACAAAGCTACGATGATTTCACTGCCAGTTTGCCAGCCAACGAGTGCCGATA
TGCTGTCTACGATTTCGATTTCACTACCGATGAGAACGTTCAAAAGAGCAAAATTTTCTTCGTTGCATGGTCTCCTGACACATCGAAGATAAGAAGTAAG
ATGTTGTATGCTAGTTCAAGGGATAGATTCAGGAGAGAGCTTGATGGGGTTCAAGTTGAGTTACAGGCGACAGATCCTAGCGAAATGAGCTTGGACATTG
TCAAGGAACGAGCCTTCTAA
AA sequence
>Potri.001G106200.1 pacid=42791560 polypeptide=Potri.001G106200.1.p locus=Potri.001G106200 ID=Potri.001G106200.1.v4.1 annot-version=v4.1
MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLPANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSK
MLYASSRDRFRRELDGVQVELQATDPSEMSLDIVKERAF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G00680 ADF8 actin depolymerizing factor 8 ... Potri.001G106200 0 1 Pt-ADF.9
AT1G14430 glyoxal oxidase-related protei... Potri.010G034200 1.00 0.8453
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Potri.003G124300 13.03 0.7737
AT1G73690 CDKD1;1, AT;CDK... cyclin-dependent kinase D1;1 (... Potri.014G079100 13.41 0.7486
AT5G18060 SAUR-like auxin-responsive pro... Potri.006G070600 27.45 0.7217
AT4G35720 Arabidopsis protein of unknown... Potri.005G103800 54.33 0.6634
AT5G19780 TUA5 tubulin alpha-5 (.1) Potri.003G220300 61.43 0.7158 TUA2
AT4G27780 ACBP2 acyl-CoA binding protein 2 (.1... Potri.012G017700 63.46 0.6948
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Potri.002G235101 63.99 0.7103
AT1G77330 2-oxoglutarate (2OG) and Fe(II... Potri.005G182700 90.62 0.7132 ACO4
AT3G10180 P-loop containing nucleoside t... Potri.006G040700 95.16 0.7178

Potri.001G106200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.