Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48980 83 / 9e-20 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT5G23850 82 / 1e-19 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT1G63420 82 / 1e-19 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT2G45830 75 / 4e-17 DTA2 downstream target of AGL15 2 (.1.2) AT2G45840 58 / 4e-11 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT3G61270 58 / 4e-11 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT3G61290 53 / 2e-09 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT3G61280 53 / 2e-09 Arabidopsis thaliana protein of unknown function (DUF821) (.1), Arabidopsis thaliana protein of unknown function (DUF821) (.2) AT1G07220 52 / 7e-09 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G125000 [exp] 103 / 4e-27 AT5G23850 603 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.015G144400 [exp] 88 / 1e-21 AT5G23850 659 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.014G081600 [exp] 86 / 6e-21 AT2G45830 613 / 0.0 downstream target of AGL15 2 (.1.2) Potri.002G157900 [exp] 74 / 9e-17 AT5G23850 537 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.002G157800 [exp] 74 / 1e-16 AT5G23850 513 / 5e-179 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.001G252000 [exp] 48 / 1e-07 AT1G07220 655 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039228 [exp] 88 / 2e-21 AT5G23850 657 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10027473 [exp] 85 / 1e-20 AT1G63420 531 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10027472 [exp] 84 / 3e-20 AT5G23850 439 / 4e-147 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10037864 [exp] 79 / 3e-18 AT2G45830 520 / 0.0 downstream target of AGL15 2 (.1.2) Lus10024519 [exp] 72 / 8e-16 AT1G63420 561 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10037863 [exp] 71 / 2e-15 AT5G23850 446 / 3e-152 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10008017 [exp] 70 / 2e-15 AT5G23850 330 / 1e-109 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10039227 [exp] 60 / 6e-13 AT3G48980 137 / 2e-39 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10040665 [exp] 49 / 7e-08 AT1G07220 688 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10018239 [exp] 48 / 2e-07 AT1G07220 686 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF05686 [poplar] [flax] Glyco_transf_90 Glycosyl transferase family 90
Representative CDS sequence Show only first row Show all	>Potri.001G106500.1 pacid=42792209 polypeptide=Potri.001G106500.1.p locus=Potri.001G106500 ID=Potri.001G106500.1.v4.1 annot-version=v4.1 ATGGCACAAGCAATTGGAAAAATAGCAAGTGCTTTCATTCAAGAAGAGCTAAAAACGGGCTCCGCATATGAATACATGTTTCTTCTCCCGAACGAGTATG CTAAGCTTCTGAAATTTAAGCCACAAGTGCCCGACGGAGCTGCTGGGATGTGCTCAGAAATTCTTGCCTGTTCCGCAGAGCATGGGTTGGAGAGGAAATT CATGATAGAATCATTTGTAAAGAAGAGTCCTCCTACTACATGTCCAGCCACCATGCCACCTCCTTTCAAACCTGGTGTTGATTTTGTTCATCATTACAAG AAACCAGAGGTATAA
AA sequence Show only first row Show all	>Potri.001G106500.1 pacid=42792209 polypeptide=Potri.001G106500.1.p locus=Potri.001G106500 ID=Potri.001G106500.1.v4.1 annot-version=v4.1 MAQAIGKIASAFIQEELKTGSAYEYMFLLPNEYAKLLKFKPQVPDGAAGMCSEILACSAEHGLERKFMIESFVKKSPPTTCPATMPPPFKPGVDFVHHYK KPEV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48980			Arabidopsis thaliana protein o...		Potri.001G106500 [exp]	0	1
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Potri.011G040300 [exp]	6.78	0.8549
AT4G02250			Plant invertase/pectin methyle...		Potri.001G127500 [exp]	10.00	0.7748
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.005G006800 [exp]	11.83	0.8471
					Potri.017G080900 [exp]	14.38	0.8461
AT5G66440			unknown protein		Potri.005G229800 [exp]	14.49	0.8379
AT5G02070			Protein kinase family protein ...		Potri.005G021300 [exp]	24.71	0.8011
AT2G42560			late embryogenesis abundant do...		Potri.019G090300 [exp]	25.09	0.8208
AT4G03540			Uncharacterised protein family...		Potri.004G043300 [exp]	26.32	0.8184
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Potri.017G099500 [exp]	26.83	0.8118
					Potri.015G020450 [exp]	27.00	0.8121

Compare expression of checked genes

Potri.001G106500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.