Plant FIBer expression Database

Potri.001G107400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G124000
[exp]
95 / 4e-27 ND /
Potri.002G228000
[exp]
74 / 5e-19 AT1G63245 44 / 3e-07 CLAVATA3/ESR-RELATED 14 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G107400.2 pacid=42793667 polypeptide=Potri.001G107400.2.p locus=Potri.001G107400 ID=Potri.001G107400.2.v4.1 annot-version=v4.1
ATGAGGATTCCAAATCCAAGACGCTCATTTCTTTTCTTGATGATCATCCTTGCTATTAGCCAGCTCTCAAGTTGCCGCTACCTCCACATAAATATAAGAG
ATCAAACAAACCAAACAGTTGAAACAGATGTCTCTACTCAGTTTTCATGGCATTTCACTGCAAAAGCTCCTGAAGGATCCAACAAAGATGAGATCGATGA
CCCAGTTTATGGAGCTTCTTATAGAACAGTTCCAGCCTCGAGAGTGGGGAAATCTTTCCATACATGA
AA sequence
>Potri.001G107400.2 pacid=42793667 polypeptide=Potri.001G107400.2.p locus=Potri.001G107400 ID=Potri.001G107400.2.v4.1 annot-version=v4.1
MRIPNPRRSFLFLMIILAISQLSSCRYLHINIRDQTNQTVETDVSTQFSWHFTAKAPEGSNKDEIDDPVYGASYRTVPASRVGKSFHT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G107400
[exp]
0 1
AT2G16770 bZIP bZIP23 Basic-leucine zipper (bZIP) tr... Potri.001G020200
[exp]
7.87 0.7942
AT1G16670 Protein kinase superfamily pro... Potri.011G142100
[exp]
13.52 0.8007
AT2G39890 ATPROT1, ProT1 proline transporter 1 (.1.2) Potri.008G062900
[exp]
14.49 0.7674 PtrProT1
AT4G12680 unknown protein Potri.007G035400
[exp]
14.83 0.7786
AT3G02720 Class I glutamine amidotransfe... Potri.017G143940
[exp]
21.42 0.7703
AT1G60680 AGD2 NAD(P)-linked oxidoreductase s... Potri.005G052400
[exp]
23.66 0.7762
AT2G46410 MYB CPC CAPRICE, Homeodomain-like supe... Potri.007G122800
[exp]
31.55 0.7784
AT1G66920 Protein kinase superfamily pro... Potri.015G018600
[exp]
32.86 0.7811
AT3G14690 CYP72A15 "cytochrome P450, family 72, s... Potri.011G101500
[exp]
42.93 0.7684
AT2G17525 Pentatricopeptide repeat (PPR)... Potri.005G102400
[exp]
48.33 0.7802

Potri.001G107400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.