Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-OLP.5
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11650 290 / 7e-100 ATOSM34 osmotin 34 (.1) AT1G75050 169 / 2e-52 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75040 165 / 8e-51 PR-5, PR5 pathogenesis-related gene 5 (.1) AT1G75030 159 / 2e-48 ATLP-3 thaumatin-like protein 3 (.1) AT1G19320 159 / 2e-48 Pathogenesis-related thaumatin superfamily protein (.1) AT1G77700 159 / 3e-47 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75800 155 / 5e-46 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38660 152 / 1e-44 Pathogenesis-related thaumatin superfamily protein (.1.2) AT5G24620 153 / 2e-44 Pathogenesis-related thaumatin superfamily protein (.1.2) AT4G24180 146 / 2e-43 ATTLP1 THAUMATIN-LIKE PROTEIN 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G107950 [exp] 461 / 1e-167 AT4G11650 287 / 6e-99 osmotin 34 (.1) Potri.001G107600 [exp] 306 / 3e-106 AT4G11650 356 / 1e-125 osmotin 34 (.1) Potri.018G096063 [exp] 305 / 6e-106 AT4G11650 314 / 2e-109 osmotin 34 (.1) Potri.001G102400 [exp] 295 / 6e-102 AT4G11650 360 / 2e-127 osmotin 34 (.1) Potri.012G004800 [exp] 168 / 4e-51 AT5G24620 358 / 1e-122 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.004G014574 [exp] 161 / 5e-49 AT1G75800 294 / 8e-100 Pathogenesis-related thaumatin superfamily protein (.1) Potri.015G000800 [exp] 160 / 4e-48 AT5G24620 351 / 4e-120 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.002G020500 [exp] 159 / 2e-47 AT1G75800 404 / 7e-142 Pathogenesis-related thaumatin superfamily protein (.1) Potri.009G132500 [exp] 159 / 3e-47 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006302 [exp] 347 / 2e-122 AT4G11650 294 / 3e-101 osmotin 34 (.1) Lus10007034 [exp] 340 / 1e-119 AT4G11650 293 / 5e-101 osmotin 34 (.1) Lus10006690 [exp] 333 / 8e-117 AT4G11650 292 / 1e-100 osmotin 34 (.1) Lus10017170 [exp] 320 / 1e-111 AT4G11650 251 / 2e-84 osmotin 34 (.1) Lus10024511 [exp] 282 / 2e-96 AT4G11650 315 / 5e-109 osmotin 34 (.1) Lus10023897 [exp] 169 / 3e-52 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1) Lus10017266 [exp] 161 / 2e-48 AT4G24180 322 / 7e-111 THAUMATIN-LIKE PROTEIN 1 (.1) Lus10025055 [exp] 155 / 2e-46 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10017265 [exp] 155 / 6e-46 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1) Lus10025629 [exp] 155 / 1e-45 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [poplar] [flax] CDC PF00314 [poplar] [flax] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Potri.001G107800.1 pacid=42790080 polypeptide=Potri.001G107800.1.p locus=Potri.001G107800 ID=Potri.001G107800.1.v4.1 annot-version=v4.1 ATGAGCTCCCTTAAAACCCTCTCAATCTTTTCCTTCCTTTTTGCTGCCCTTCATTTCCCCTCTGTCCATGCAGCCACATTTGATATAACAAACAAATGTC CCTACACGGTTTGGGCTGCAGCTAAGCCTGGGGGTGGCAGGCAACTTAACAATGGTGAGACATGGACCATTAGTGCTGACCCTGGCACCACACAAGCACG CATTTGGGCTCGAACCAATTGCCAATTTGATGGTGCTGGAAGGGGCAACTGCCAGACTGGTGACTGCAATGGGCTCCTAGCATGCCAAGGCTATGGTTCA CCCCCTAACACCCTAGCCGAATACGCAATCGGCCAATTTGCAAACCAAGATTTCATTGATATCTCTAACATTGATGGATTTAATGTTCCTATGGAATTCA GCTCGGCCTCTGCAGGTTGTACCCGCGTGATCAAATGCACAGCAGATATCGTTGGACAGTGCCCTAATGAATTGAAGGTCCCTGGAGGGTGCAATGGACC ATGTCCTGTGTTCAAAACTGACGAGTATTGTTGCAATTCAGGCACCTGTGGTCCTACTACTTTCTCAAAGTATTTCAAGGAGAGGTGCCCAGATGCTTAT AGTTATCCCAAGGATGATCCTACAAGTTTGTTTACCTGCCCCACTGGGACTAACTATAAGGTCATATTCTGCCCATGA
AA sequence Show only first row Show all	>Potri.001G107800.1 pacid=42790080 polypeptide=Potri.001G107800.1.p locus=Potri.001G107800 ID=Potri.001G107800.1.v4.1 annot-version=v4.1 MSSLKTLSIFSFLFAALHFPSVHAATFDITNKCPYTVWAAAKPGGGRQLNNGETWTISADPGTTQARIWARTNCQFDGAGRGNCQTGDCNGLLACQGYGS PPNTLAEYAIGQFANQDFIDISNIDGFNVPMEFSSASAGCTRVIKCTADIVGQCPNELKVPGGCNGPCPVFKTDEYCCNSGTCGPTTFSKYFKERCPDAY SYPKDDPTSLFTCPTGTNYKVIFCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.001G107800 [exp]	0	1	Pt-OLP.5
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.001G107950 [exp]	1.00	0.9987
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Potri.010G140000 [exp]	7.74	0.9722
AT4G16260			Glycosyl hydrolase superfamily...		Potri.001G255100 [exp]	22.18	0.9745	Pt-GNS1.4
AT3G25830		ATTPS-CIN	"terpene synthase-like sequenc...		Potri.011G031800 [exp]	24.33	0.9735
					Potri.004G206700 [exp]	26.66	0.9661
					Potri.003G108301 [exp]	30.19	0.9705
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024000 [exp]	37.97	0.9698
AT5G51920			Pyridoxal phosphate (PLP)-depe...		Potri.003G120500 [exp]	38.72	0.9570
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024100 [exp]	41.37	0.9676	Pt-CHI3.8
AT5G24090		ATCHIA	chitinase A (.1)		Potri.012G033899 [exp]	42.42	0.9351

Compare expression of checked genes

Potri.001G107800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.