Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47670 122 / 2e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G14300 122 / 2e-31 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) AT1G53840 104 / 2e-25 ATPME1 pectin methylesterase 1 (.1) AT2G01610 74 / 8e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 73 / 1e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 68 / 9e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G51520 64 / 2e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 64 / 3e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G04960 64 / 1e-11 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G62360 61 / 6e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G123500 [exp] 318 / 5e-111 AT3G47670 141 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G072700 [exp] 152 / 1e-42 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1) Potri.001G162700 [exp] 137 / 2e-37 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1) Potri.006G134800 [exp] 82 / 7e-18 AT1G53840 505 / 1e-173 pectin methylesterase 1 (.1) Potri.010G109300 [exp] 75 / 3e-16 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 74 / 9e-16 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G011200 [exp] 71 / 6e-14 AT3G10710 621 / 0.0 root hair specific 12 (.1) Potri.010G247600 [exp] 71 / 6e-14 AT3G10710 609 / 0.0 root hair specific 12 (.1) Potri.015G128100 [exp] 67 / 2e-13 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008625 [exp] 130 / 8e-37 AT3G47670 146 / 8e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10037457 [exp] 123 / 1e-33 AT1G53840 234 / 1e-72 pectin methylesterase 1 (.1) Lus10042193 [exp] 125 / 2e-32 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10003934 [exp] 122 / 2e-31 AT3G14300 663 / 0.0 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10031138 [exp] 81 / 3e-18 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 79 / 7e-18 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 78 / 1e-17 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10033399 [exp] 77 / 6e-16 AT3G10710 606 / 0.0 root hair specific 12 (.1) Lus10034859 [exp] 74 / 6e-15 AT3G10710 561 / 0.0 root hair specific 12 (.1) Lus10038645 [exp] 71 / 2e-14 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.001G108200.1 pacid=42791460 polypeptide=Potri.001G108200.1.p locus=Potri.001G108200 ID=Potri.001G108200.1.v4.1 annot-version=v4.1 ATGGAATCCATTAAATTGTTCAGAGGCTATGGCAAAGTGAATCCGCACCTTGAAGATCAAAGCCCTCACCAACAACACAGTGCTTCAAAACGCCGAATCC TCATCTTCAGCGTTTCATCCATCCTCCTTTTGACTCTAATCATCGGTATAGCGCTTGCAACATTGATCCATGAGTCAAATAGTGAGCCAGATGAATCCCC GTATCTCTCCTCATCAAACCCAGCTGAGTCGATCAAAACGGTCTGTGACGTGACTCTGTATCCATCCTCCTGCTTCACAAGCATATCCTCTCTTAACATC TCAACTAAACCTGACCCAGAAGTCATCTTCAAGCTCTCTCTCCAAGTCTCCATTGCAGAACTCAAGAACCTCTCTTCTTTATTGAGTAGTTTCAATGATG TTAACTCTCAGGCTGCTTTGAAAGATTGTGTGAGTCAGTTTGATGATTCCCTGAGTAAACTCAACGATTCTTTGTCGGCCATGGAGGTTGGACCTGGAGA GAAGATGTTGAATTTGGAAAAGGTCAACGACATCCGGACATGGATCAGTGCTGCCATGACAGATCAAGATACTTGCATGGACGGTTTGGAGGAGATGGGA TCGAAGTTTCTTGATGAGATCAAGGCCAAGATAGAGAGATCTAAGGAGTTCTTGAGTATTAGCTTGGCTATCATTGCTAAGATGCAAGCTCTTCTTGAAA AATTTGATCTAAAAATGCATTGA
AA sequence Show only first row Show all	>Potri.001G108200.1 pacid=42791460 polypeptide=Potri.001G108200.1.p locus=Potri.001G108200 ID=Potri.001G108200.1.v4.1 annot-version=v4.1 MESIKLFRGYGKVNPHLEDQSPHQQHSASKRRILIFSVSSILLLTLIIGIALATLIHESNSEPDESPYLSSSNPAESIKTVCDVTLYPSSCFTSISSLNI STKPDPEVIFKLSLQVSIAELKNLSSLLSSFNDVNSQAALKDCVSQFDDSLSKLNDSLSAMEVGPGEKMLNLEKVNDIRTWISAAMTDQDTCMDGLEEMG SKFLDEIKAKIERSKEFLSISLAIIAKMQALLEKFDLKMH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47670			Plant invertase/pectin methyle...		Potri.001G108200 [exp]	0	1
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Potri.007G093600 [exp]	2.23	0.7222	Pt-UBP3.1
AT3G66654			Cyclophilin-like peptidyl-prol...		Potri.008G105800 [exp]	6.32	0.7078
AT1G26580			unknown protein		Potri.008G094400 [exp]	7.34	0.6124
AT1G23780			F-box family protein (.1)		Potri.015G020600 [exp]	7.74	0.6311
AT4G05320		UBQ10	polyubiquitin 10 (.1.2.3.4.5.6...		Potri.001G418500 [exp]	8.30	0.6938
AT5G46170			F-box family protein (.1)		Potri.004G065900 [exp]	11.40	0.6209
AT1G26830		CUL3A, ATCUL3A,...	cullin 3A, cullin 3 (.1)		Potri.010G093200 [exp]	13.41	0.5986	CUL3.2
AT3G53490			unknown protein		Potri.016G081900 [exp]	15.90	0.6079
AT2G17030			F-box family protein with a do...		Potri.009G140000 [exp]	17.74	0.6507
AT3G60680			Plant protein of unknown funct...		Potri.002G145000 [exp]	25.69	0.6098

Compare expression of checked genes

Potri.001G108200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.